DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and PAN2

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_011421.1 Gene:PAN2 / 852786 SGDID:S000003062 Length:1115 Species:Saccharomyces cerevisiae


Alignment Length:287 Identity:55/287 - (19%)
Similarity:89/287 - (31%) Gaps:120/287 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 LPSPVCLVAHNGWGFDF-----PILR-------QAFEKLNI------------------------ 152
            ||: |.:||.:...|||     |.||       |:.:||.:                        
Yeast   266 LPT-VMIVASSSGSFDFIDLSNPTLRTQYVHPCQSIKKLCLSPNGDVLGILEADNHLDTWRRSSN 329

  Fly   153 ------ELPQSLTCVDSLRAF-----MEIDDTQQKET---SQLKVPNDVQEI------------- 190
                  ..|:.|...|.....     :.:||    ||   |.:.:|..:.::             
Yeast   330 NMGMFTNTPEMLAYPDYFNDITSDGPISVDD----ETYPLSSVGMPYYLDKLLSAWPPVVFKSEG 390

  Fly   191 -IPELKPKQNTETC--LKEPEAVVNIDWRTRNE--TTPNRPILK-------PTEAFAKRKLLRDG 243
             ||:|..|....:.  ||...||::    ::||  :|...|:|:       ...|......||| 
Yeast   391 TIPQLTGKSPLPSSGKLKSNLAVIS----SQNEKLSTQEFPLLRYDRTKYGMRNAIPDYVCLRD- 450

  Fly   244 DEDDLEEQTPPKRKPDEFRSRRQLFSGCKCAENKRYPPRGVYNLESLYTRI-------------- 294
                               .|:|:.||.:.::.:.|.....|.:...|:|:              
Yeast   451 -------------------IRKQITSGLETSDIQTYTSINKYEVPPAYSRLPLTSGRFGTDNFDF 496

  Fly   295 --FKIPALSAHQAEADVVMTTKLIQHY 319
              |.....|....:.|...|..:||.|
Yeast   497 TPFNNTEYSGLDPDVDNHYTNAIIQLY 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 14/72 (19%)
TREX1_2 20..173 CDD:99839 18/95 (19%)
PAN2NP_011421.1 WD40 <15..352 CDD:225201 17/86 (20%)
UCH_1 505..829 CDD:404327 6/19 (32%)
PAN2_exo 907..1080 CDD:99846
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.