DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and DPD1

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_198046.1 Gene:DPD1 / 832752 AraportID:AT5G26940 Length:316 Species:Arabidopsis thaliana


Alignment Length:194 Identity:51/194 - (26%)
Similarity:75/194 - (38%) Gaps:51/194 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KISTFAVLDLETTNLPAYRNNRVSITELCI-------YAFEAALLKKKKKEQDQDEQQELPAAPR 73
            |:.|..|.|||||.|  :|.|. .|.|:..       |:....|:          ....:|....
plant   107 KLLTVIVSDLETTGL--HRKNE-RIIEIAAQDIAGGGYSTFQTLV----------NPGVVPITNA 158

  Fly    74 VLHKLNVLFQPSMVVDPEAERITGLSNYLLERESQLDTDAAQLIVSFLKHLPSP------VCLVA 132
            .:|.:    :..||..||..|:                  .:||..||:::.|.      |.|||
plant   159 HIHGI----RNDMVCRPEVPRM------------------EELIPIFLRYVESRQKPGGYVMLVA 201

  Fly   133 HNGWGFDFPILRQAFEKLNIELPQSLTCVDSL---RAFMEIDDTQQKETSQLKVPNDVQEIIPE 193
            |||..|||..|...|.:.:.|:|.:...:|||   |..|:..:...|.:|.|:...|...:..|
plant   202 HNGKSFDFQFLINEFNRCSYEIPHNWLLLDSLPLARENMKSVEPTVKLSSSLEALADYYSLTRE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 39/148 (26%)
TREX1_2 20..173 CDD:99839 44/168 (26%)
DPD1NP_198046.1 EXOIII 110..290 CDD:214685 50/191 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1365966at2759
OrthoFinder 1 1.000 - - FOG0003419
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13058
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.