DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and AT4G39810

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_195691.4 Gene:AT4G39810 / 830140 AraportID:AT4G39810 Length:255 Species:Arabidopsis thaliana


Alignment Length:173 Identity:40/173 - (23%)
Similarity:62/173 - (35%) Gaps:34/173 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ISTF----AVLDLETTNLPAYRNNRVSITELCIYAFEAALLKKKKKEQDQDEQQELPAAPRVLHK 77
            :.||    ...||| ||:|........|.|     |.|.::..||.|:              |..
plant     3 VQTFPNEIVFFDLE-TNVPNKAGQHFHILE-----FGAIIVCPKKLEE--------------LES 47

  Fly    78 LNVLFQPS--MVVDPEAERITGLSNYLLERESQLDTDAAQLIVSFLKHLPSPVCLVAHNGWGFDF 140
            ...|.||.  .||...:.|..|::...:......: |.|:.|...|    :......||...||.
plant    48 FTTLIQPKDLSVVSIRSSRSDGITRAKVTNAPSFE-DVAEKIHGLL----NGRIWAGHNIRRFDC 107

  Fly   141 PILRQAFEKLNIELPQSLTCVDSLRAFMEIDDTQQKETSQLKV 183
            ..:::||.::....|:....:|||..   :.|...|....:|:
plant   108 VRIKEAFAEIGKAAPEPSGIIDSLGL---LSDKFGKRAGNMKM 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 33/141 (23%)
TREX1_2 20..173 CDD:99839 36/158 (23%)
AT4G39810NP_195691.4 DnaQ 5..>183 CDD:223916 40/171 (23%)
EXOIII 9..182 CDD:214685 38/167 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1365966at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.