DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and REXO5

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001185982.1 Gene:REXO5 / 81691 HGNCID:24661 Length:774 Species:Homo sapiens


Alignment Length:286 Identity:54/286 - (18%)
Similarity:91/286 - (31%) Gaps:87/286 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VLHKLNVLFQPSMVVDPEAERITGLSNYLLERESQLDTDAAQLIVSFLKHLPSPVCLVAHNGWGF 138
            |..:|..|..|..|              |:.....||..|.::|..::  :.:.:..|...|..|
Human   293 VQRQLKALLPPDAV--------------LVGHSLDLDLRALKMIHPYV--IDTSLLYVREQGRRF 341

  Fly   139 DFPILRQAFEKLNIELPQSL---------TCVDSLRAFMEIDDTQQKETSQLKVPNDVQEIIPEL 194
            ....|.:.....:|:.|..|         |.::..|.|::....:..|.:...:.|. |||....
Human   342 KLKFLAKVILGKDIQCPDRLGHDATEDARTILELARYFLKHGPKKIAELNLEALANH-QEIQAAG 405

  Fly   195 KPKQNTETCLKEPEAVVNIDWRTRNETTPNRPILKPTEAFAKRKLL--RDGDEDDLEEQTPPKRK 257
            :..:||...|:.                ||..:|:..::..::.|.  |:.|..:|    |..| 
Human   406 QEPKNTAEVLQH----------------PNTSVLECLDSVGQKLLFLTRETDAGEL----PSSR- 449

  Fly   258 PDEFRSRRQLFSGC---KCAENKRYPPRGVYNLESLYTRI---------FKIPALSAHQAEADVV 310
                        .|   ||..||..       ||.....|         |...|.|.       |
Human   450 ------------NCQTIKCLSNKEV-------LEQARVEIPLFPFSIVQFSFKAFSP-------V 488

  Fly   311 MTTKLIQHYGIDFLAFAEEQAIPFQQ 336
            :|.::.:...|.:...:...|.||.:
Human   489 LTEEMNKRMRIKWTEISTVYAGPFSK 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 15/80 (19%)
TREX1_2 20..173 CDD:99839 20/107 (19%)
REXO5NP_001185982.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
REX1_like 229..377 CDD:99848 18/99 (18%)
RRM1_NEFsp 506..576 CDD:240719 3/9 (33%)
RRM_SF 602..672 CDD:327398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.