DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and Rexo1

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_011241832.1 Gene:Rexo1 / 66932 MGIID:1914182 Length:1228 Species:Mus musculus


Alignment Length:354 Identity:70/354 - (19%)
Similarity:121/354 - (34%) Gaps:112/354 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PNDAVAEHAEEQPKISTFAVLDLETTNL--------PAYRNNRVSITELCIYAFEAALLKKKKKE 59
            |:..:|..|....|:|:..:::.:..:|        |..:...:|..||.             .:
Mouse   461 PHAPLAWKAGSAKKMSSGKLVERKARSLDEGAPQDTPKLKKRALSHAELF-------------GD 512

  Fly    60 QDQDEQQELPA-APRVLHKLNVLFQPSMVVDPEAERITGLSNYLLERESQLDTDAAQLIVSFLKH 123
            :.::|...|.| ||||....    .||:..|.|:           :.:|.|..|..: :...||.
Mouse   513 ESEEEDSSLGAGAPRVWPPT----LPSLSSDSES-----------DSDSSLGLDETK-VPKRLKA 561

  Fly   124 L-------PSPVCLVAHNGWG-------FDFPILRQAFEKLNIELPQSLTCVDSLRAFMEIDDTQ 174
            .       |||:...:.:...       .|:..|.   ::::.::.....|   ||.|.|....:
Mouse   562 APPASPVPPSPLSSSSSSSGASQCAEEDVDYSALE---KEVDFDVDPMEEC---LRIFNESTSVK 620

  Fly   175 QKETSQL-KVPNDVQEIIPELKPKQNTETCLKEPEAVVNIDWRTRNETTPNRPILKPTEAFAKRK 238
            .::..:| :.|       |:.|.::.|...|                ||     |.|.:......
Mouse   621 TEDKGRLARQP-------PKEKAEEKTHAGL----------------TT-----LFPGQKRRVSH 657

  Fly   239 LLRDGDEDDLEEQT---PPKRKP--DEFRSRRQLFSGCKCAENKRYPPRGVYNLESLY------- 291
            |.:.|.|.:..::|   ||.|.|  .|...||...:....|...:..||....|.|::       
Mouse   658 LCKPGKESEAPKRTPVAPPARPPTAQEVCYRRAQLAQRDSASWLQAAPRPTERLSSVHISAPGEK 722

  Fly   292 TRIFKIP-------------ALSAHQAEA 307
            .||..:|             ||||..::|
Mouse   723 RRIAHVPNPRLAAAPTGAKRALSASSSQA 751

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 26/158 (16%)
TREX1_2 20..173 CDD:99839 31/175 (18%)
Rexo1XP_011241832.1 PHA03307 150..>461 CDD:223039 70/354 (20%)
EloA-BP1 794..969 CDD:374185
REX1_like 1068..1216 CDD:99848
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.