DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and AEN

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_073604.3 Gene:AEN / 64782 HGNCID:25722 Length:325 Species:Homo sapiens


Alignment Length:247 Identity:46/247 - (18%)
Similarity:78/247 - (31%) Gaps:85/247 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ELPAAPRVLHKLNVLF----QPSMVVDPEAERITGLSNYLLERESQLDTDAAQLIVSFLKHLPSP 127
            ||.....|.:..|||:    :|.|.:.....|.:|::...:.:.........::    ||.|...
Human   128 ELARCSIVSYHGNVLYDKYIRPEMPIADYRTRWSGITRQHMRKAVPFQVAQKEI----LKLLKGK 188

  Fly   128 VCLVAHNGWGFDFPILRQAFEKLNIELPQSLTCVDSLRAFMEIDDTQQKETSQLKVPNDVQEIIP 192
            | :|.|        .|...|:.|....|:|                |.::|:.  |||.:.|  |
Human   189 V-VVGH--------ALHNDFQALKYVHPRS----------------QTRDTTY--VPNFLSE--P 224

  Fly   193 ELKPKQNTE--------------------------TCLKEPEAVVNIDWRTRNETTPNRPILKPT 231
            .|..:....                          |...|...:|.:.|..:             
Human   225 GLHTRARVSLKDLALQLLHKKIQVGQHGHSSVEDATTAMELYRLVEVQWEQQ------------- 276

  Fly   232 EAFAKRKLLRDGDED---DLEEQTPPKRKPDEFR--SRRQLFSGCKCAENKR 278
            ||.:......|.:.|   |:|:....:..||:..  ||    .|.:.|:::|
Human   277 EARSLWTCPEDREPDSSTDMEQYMEDQYWPDDLAHGSR----GGAREAQDRR 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 19/91 (21%)
TREX1_2 20..173 CDD:99839 21/109 (19%)
AENNP_073604.3 Nucleolar localization signal 27..35
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..105
DnaQ 106..314 CDD:223916 41/231 (18%)
DnaQ_like_exo 111..267 CDD:299142 31/171 (18%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:18264133 165..188 3/26 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..325 11/48 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.