Sequence 1: | NP_001285571.1 | Gene: | CG3165 / 33503 | FlyBaseID: | FBgn0031484 | Length: | 351 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_065118.2 | Gene: | REXO4 / 57109 | HGNCID: | 12820 | Length: | 422 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 38/206 - (18%) |
---|---|---|---|
Similarity: | 74/206 - (35%) | Gaps: | 55/206 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 KKKKEQDQDEQQELPAAPRVLHKLNVLFQPSMVVDPE------AERITGLSNYLLERESQLDTDA 113
Fly 114 AQLIVSFLKHLPSPVCLVAHNGWGFDFPILRQAFEKLNIELPQSLTCVDSLRAFMEIDDTQQKET 178
Fly 179 SQLKVPN----DVQEIIPELKPK--QNTETCLKEPEAVVNIDWRTRNETTPNRPILKPTEAFAKR 237
Fly 238 KLLRDGDEDDL 248 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3165 | NP_001285571.1 | DnaQ | 19..>155 | CDD:223916 | 20/105 (19%) |
TREX1_2 | 20..173 | CDD:99839 | 21/123 (17%) | ||
REXO4 | NP_065118.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..194 | 37/204 (18%) | |
REX4_like | 244..394 | CDD:99847 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0847 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |