DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and REXO4

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_065118.2 Gene:REXO4 / 57109 HGNCID:12820 Length:422 Species:Homo sapiens


Alignment Length:206 Identity:38/206 - (18%)
Similarity:74/206 - (35%) Gaps:55/206 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KKKKEQDQDEQQELPAAPRVLHKLNVLFQPSMVVDPE------AERITGLSNYLLERESQLDTDA 113
            ||||...:.:.:|:...|        ...|..||.|.      ::....|..:||:::||  ...
Human    32 KKKKRFWKSKAREVSKKP--------ASGPGAVVRPPKAPEDFSQNWKALQEWLLKQKSQ--APE 86

  Fly   114 AQLIVSFLKHLPSPVCLVAHNGWGFDFPILRQAFEKLNIELPQSLTCVDSLRAFMEIDDTQQKET 178
            ..|::|.:.....|             .|::|..::.:.::...           |:...:.:|.
Human    87 KPLVISQMGSKKKP-------------KIIQQNKKETSPQVKGE-----------EMPAGKDQEA 127

  Fly   179 SQLKVPN----DVQEIIPELKPK--QNTETCLKEPEAVVNIDWRTRNETTPNRPILKPTEAFAKR 237
            |:..||:    |.:..:|..|..  ::.:...||         ||..:..|.|..::..:..||.
Human   128 SRGSVPSGSKMDRRAPVPRTKASGTEHNKKGTKE---------RTNGDIVPERGDIEHKKRKAKE 183

  Fly   238 KLLRDGDEDDL 248
            .......|:|:
Human   184 AAPAPPTEEDI 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 20/105 (19%)
TREX1_2 20..173 CDD:99839 21/123 (17%)
REXO4NP_065118.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..194 37/204 (18%)
REX4_like 244..394 CDD:99847
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.