DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and REXO4

DIOPT Version :10

Sequence 1:NP_608732.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_065118.2 Gene:REXO4 / 57109 HGNCID:12820 Length:422 Species:Homo sapiens


Alignment Length:206 Identity:38/206 - (18%)
Similarity:74/206 - (35%) Gaps:55/206 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KKKKEQDQDEQQELPAAPRVLHKLNVLFQPSMVVDPE------AERITGLSNYLLERESQLDTDA 113
            ||||...:.:.:|:...|        ...|..||.|.      ::....|..:||:::||  ...
Human    32 KKKKRFWKSKAREVSKKP--------ASGPGAVVRPPKAPEDFSQNWKALQEWLLKQKSQ--APE 86

  Fly   114 AQLIVSFLKHLPSPVCLVAHNGWGFDFPILRQAFEKLNIELPQSLTCVDSLRAFMEIDDTQQKET 178
            ..|::|.:.....|             .|::|..::.:.::...           |:...:.:|.
Human    87 KPLVISQMGSKKKP-------------KIIQQNKKETSPQVKGE-----------EMPAGKDQEA 127

  Fly   179 SQLKVPN----DVQEIIPELKPK--QNTETCLKEPEAVVNIDWRTRNETTPNRPILKPTEAFAKR 237
            |:..||:    |.:..:|..|..  ::.:...||         ||..:..|.|..::..:..||.
Human   128 SRGSVPSGSKMDRRAPVPRTKASGTEHNKKGTKE---------RTNGDIVPERGDIEHKKRKAKE 183

  Fly   238 KLLRDGDEDDL 248
            .......|:|:
Human   184 AAPAPPTEEDI 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_608732.1 TREX1_2 20..173 CDD:99839 21/123 (17%)
REXO4NP_065118.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..194 37/204 (18%)
REX4_like 244..394 CDD:99847
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.