DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and zgc:152968

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001314684.1 Gene:zgc:152968 / 564848 ZFINID:ZDB-GENE-061013-448 Length:1251 Species:Danio rerio


Alignment Length:304 Identity:64/304 - (21%)
Similarity:113/304 - (37%) Gaps:78/304 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 VDPEAERITGLSNYLLERESQLDTDAAQLIVSFLK------------HLPS--PVCLVAHNGWGF 138
            |:.|.:|   ||.|   :.||..|...|....:|:            ||.|  |||..:...:  
Zfish    83 VEKEQKR---LSQY---QTSQSLTQTGQCSGKYLRTTKSRPKDQNGNHLKSKKPVCSTSGQKY-- 139

  Fly   139 DFPILRQAFEKLNIE----------LPQSLTCVDSLRAFMEID---DTQQKETSQLKVP-----N 185
               ::.:|..|.::|          |..|.:....|::..::|   ..:.|:|.:...|     :
Zfish   140 ---VVDRARPKTDLEYDPCSNFSADLLSSSSAECKLKSSDKVDIDHGLKSKQTGKNVQPLSSHFD 201

  Fly   186 DVQE------IIPEL-------KPKQNTETCLKEPEAV-----VNIDWRTRNETTPNRPILKPTE 232
            |.::      .||.|       ||||.: ..:|.|..:     ||.| .:..:|.||:...|.::
Zfish   202 DSEDEGTLVIDIPSLTKDHRKHKPKQES-AIIKTPHVLERNGAVNND-LSNQQTNPNQHKEKSSD 264

  Fly   233 AFAKRKLLRD-GDEDDLEEQTPPKRKPDEFRSRR-QLFSGCKCAENKRYPPRGVYNLESLYTRIF 295
            .....::.|. .|:::......|....:|..|.. :|.......|::...|:   ..||....:.
Zfish   265 GLPSHEMKRTVSDQENARTLVKPMMITEEQESSEGELVIDVSQFEDEHKLPQ---QRESKNKELL 326

  Fly   296 KIPAL-------SAHQAEAD---VVMTTKLIQHYGIDFLAFAEE 329
            .:|.|       :.|..||:   ::....:..|.|.|...|.|:
Zfish   327 DLPKLCPVSNAPAEHYKEANDGQIIKGITMANHPGKDIEPFLED 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 20/90 (22%)
TREX1_2 20..173 CDD:99839 24/111 (22%)
zgc:152968NP_001314684.1 EloA-BP1 855..989 CDD:292495
REX1_like 1090..1239 CDD:99848
DnaQ 1091..>1239 CDD:223916
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.