DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and rexo1

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001119888.1 Gene:rexo1 / 564551 ZFINID:ZDB-GENE-030131-1650 Length:1207 Species:Danio rerio


Alignment Length:336 Identity:58/336 - (17%)
Similarity:119/336 - (35%) Gaps:81/336 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DAVAEHAEEQPKISTFAVLDLETTNLPA--YRNNRVSITEL------------CIYAFEAALLKK 55
            |..:|:. ..|..|.: .||.|.||..|  |....||.:.:            |.|..:.:   |
Zfish   155 DQASEYT-PSPHSSKY-TLDTENTNANALEYVPTAVSKSNIKKLTPRPPSHAKCKYTLDTS---K 214

  Fly    56 KKKEQDQDEQQELPAAPRVLHKLNVLF----QPSMVVDPEAERITGLSNYLLERESQLDTDAAQL 116
            ...:.:.|......|.|.:..:..:..    :..:..:.:.|....:......:.|....|..:.
Zfish   215 PTTDMEYDPLSNYSAKPTIKEQKTLALAGQRRKRLYSEKQGEAEEYVPTVKKPKSSFTKADVPKY 279

  Fly   117 IVSF---------LKHLPSPVCLVAHNGWGFDFPILRQAFEKLNIELPQS---------LTCVDS 163
            ..||         .::.|..|..:.||              ::||.||:|         ::..|:
Zfish   280 TASFSESDEESSGTEYRPVNVSRLKHN--------------RINIGLPKSSAMGQQKKQISKTDA 330

  Fly   164 LRAFMEIDDTQQKETSQLKVPNDVQEIIPELKPKQNTETCLKEPEAVVNIDWRTRNETTPNRPIL 228
            ..:..|.|||:.::.::.....|.:....:.|..: |:...||.:   :.:.:::.|...:..:.
Zfish   331 YFSPCESDDTESQDVNRTNKKTDKKVSASQTKTNK-TDKVKKENK---DSNKKSQKEQQDSSSVD 391

  Fly   229 KPTEAFAKRKLLRDGDEDDLEEQTPPKRKPDEFRSRRQLFSGCKCAENKRYPPRGVYNLESLYTR 293
            |.:::.:|:.   :....::|..:..|.|..:.:      |..|.||.|.             .:
Zfish   392 KTSKSSSKKD---NSQSKNIEGSSKSKEKSHKDK------SASKSAEEKD-------------KK 434

  Fly   294 IFKIPALSAHQ 304
            :.||...|:|:
Zfish   435 VVKIKTESSHK 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 26/162 (16%)
TREX1_2 20..173 CDD:99839 32/188 (17%)
rexo1NP_001119888.1 EloA-BP1 785..948 CDD:292495
REX1_like 1047..1195 CDD:99848
DnaQ 1060..>1196 CDD:223916
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.