DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and CG12877

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001034073.1 Gene:CG12877 / 43333 FlyBaseID:FBgn0039544 Length:991 Species:Drosophila melanogaster


Alignment Length:194 Identity:44/194 - (22%)
Similarity:68/194 - (35%) Gaps:67/194 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 PSPVCLVAHNGWGFDFPILRQAFEKLNIELPQSLTC----------------------------- 160
            ||||            |..:.|.:.|::.|||...|                             
  Fly    47 PSPV------------PKYKPAPKLLSLPLPQITLCAPRKKSNLEYHPEKPALDASPAKKKQEAS 99

  Fly   161 VDSLRAFM----------EIDDTQ---QKE-TSQLKVPNDVQEIIPELKPKQNTETCLKEPEAVV 211
            |||...::          |.||.|   :|| ..|::|  :::|.:.....:|..:|..:..|...
  Fly   100 VDSAPKYVPGQPSVTNGEEYDDWQAVLEKEIDEQMQV--EIEEQVQNNDEEQKIDTVAENEEDQE 162

  Fly   212 N---IDWRTRNE--TTPN----RPILKPTEAFAKRKLLRDGDEDDLEEQTPPKRKPDEFRSRRQ 266
            |   .|.|..:|  ..|:    |.|.|......||:.::|.|.|...::...|.|..| |.|.:
  Fly   163 NTQLTDARDSHEKDRKPSKERERDIEKKKIRELKREKIKDRDRDRDRDREKDKEKSKE-RDREK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 7/29 (24%)
TREX1_2 20..173 CDD:99839 16/86 (19%)
CG12877NP_001034073.1 CDC45 129..>199 CDD:280821 17/71 (24%)
EloA-BP1 572..736 CDD:292495
REX1_like 834..983 CDD:99848
DnaQ 847..>991 CDD:223916
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.