DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and Pan2

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001382635.1 Gene:Pan2 / 408200 RGDID:1303301 Length:1207 Species:Rattus norvegicus


Alignment Length:96 Identity:25/96 - (26%)
Similarity:42/96 - (43%) Gaps:16/96 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AVLDLETTNLPA-YRNNRVSITELCIYAFEAALLKKKKKEQDQDEQQELPAAPRVLHKLNVLFQP 84
            |:|.....||.: |..|..:..|..:...||:|.:|::|    .....:|.      .||.:.|.
  Rat   922 AILYYVKRNLNSRYNLNIKNPIEASVLLAEASLARKQRK----THTTFIPL------MLNEMPQV 976

  Fly    85 SMVVDPEAERITGLSNYLLERESQLDTDAAQ 115
            ..:|..:||.:|     |.|.|::|.:|..:
  Rat   977 GDLVGLDAEFVT-----LNEEEAELRSDGTK 1002

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 25/96 (26%)
TREX1_2 20..173 CDD:99839 25/96 (26%)
Pan2NP_001382635.1 WD 1. /evidence=ECO:0000255|HAMAP-Rule:MF_03182 153..193
WD 2. /evidence=ECO:0000255|HAMAP-Rule:MF_03182 195..231
WD 3. /evidence=ECO:0000255|HAMAP-Rule:MF_03182 244..280
WD 4. /evidence=ECO:0000255|HAMAP-Rule:MF_03182 328..367
Linker. /evidence=ECO:0000255|HAMAP-Rule:MF_03182 368..484
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.