DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and CG6833

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster


Alignment Length:163 Identity:25/163 - (15%)
Similarity:54/163 - (33%) Gaps:62/163 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 ETTPNRPILKPTEAFAKRKLLRD--------------GDEDD---------------LEEQTPPK 255
            :.|.:.|:.|......|:|..|:              ...||               |::...|:
  Fly    93 KATESAPLSKSARMRMKKKAHRNRILAMDCEMVGVGHNTRDDMLARVSIVNRMGHVLLDKYVKPR 157

  Fly   256 RKPDEFRSRRQLFSGCKCAENKRYPPRGVYNLESLYTRIFKIPALSAHQAEADVVMTTKLIQHYG 320
            ::..::|:.   .||.:        |:.:.|.|.          .:|.|.|...::..:::..:|
  Fly   158 KEVTDYRTS---VSGIR--------PQDIANGED----------FAAVQNEVMKLIHGRILVGHG 201

  Fly   321 IDFLAFAEEQAI-----PFQQVVPLG--SPVCR 346
            :     ..:.|:     ||..:....  .|:|:
  Fly   202 L-----RNDLAVLGIRHPFHDIRDTSHYKPLCK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916
TREX1_2 20..173 CDD:99839
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 23/156 (15%)
REX4_like 118..270 CDD:99847 19/138 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.