DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and Rexo5

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_648050.1 Gene:Rexo5 / 38740 FlyBaseID:FBgn0286051 Length:681 Species:Drosophila melanogaster


Alignment Length:231 Identity:49/231 - (21%)
Similarity:81/231 - (35%) Gaps:69/231 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EEQPKISTFAVLDLETTNLPAYR-----NNRVSITEL---------CIYAFEAALLKKKKKEQDQ 62
            |.|..|...|.:.|  ||..|.|     .:..|..||         .|:..|::    |.:..|.
  Fly   244 EGQKIIDEIAKIPL--TNAQARRLIDEHGSLESAVELNKDPTLFVKTIFPIESS----KSESDDM 302

  Fly    63 DEQQELPAAPRVLHKLNVLFQPSMVVDPEAERITGLSNYLLERESQLDTDAAQLIVSFLKHLPSP 127
            .|..:.|       :..:|.....:||         ..|.:..:.:|.|.....  .|.|.|.:|
  Fly   303 HEDDKFP-------RTKLLLSALQMVD---------EGYPIPLQGELHTRFQNF--KFTKDLYAP 349

  Fly   128 V----------CLVAHNGWGFD----FPILRQAFEKL--NIELPQSLTCVDSLRAFMEID-DTQQ 175
            |          |.:.|...|.:    ..|:.:.:|.:  .:.||.: ...|.|..:..|. :..:
  Fly   350 VTNRSPMFGVDCEMCHTEAGCNELTRISIVNENYETVYETLVLPNN-RITDYLTQYSGITAEIME 413

  Fly   176 KETSQLKVPNDVQEIIPELKPKQNTETCLKEPEAVV 211
            :.|.:|.|   ||:.:.||.|          |:|::
  Fly   414 QVTKRLDV---VQKEVSELLP----------PDAIL 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 31/165 (19%)
TREX1_2 20..173 CDD:99839 36/183 (20%)
Rexo5NP_648050.1 REX1_like 357..507 CDD:99848 20/94 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.