DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and ISG20

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001290162.1 Gene:ISG20 / 3669 HGNCID:6130 Length:181 Species:Homo sapiens


Alignment Length:139 Identity:29/139 - (20%)
Similarity:53/139 - (38%) Gaps:44/139 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 QQELPAAPRVLHKLNV--LFQPSMVV------DPEA--ERITGLSNY------LLERESQLD--- 110
            |..:.|.|..:.:|.:  |.:..:||      |.:|  |.::|.:.|      ||.||::||   
Human    62 QHMVGATPFAVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCR 126

  Fly   111 TDAAQLIVSFLKHLPSPVCLVAHNGWGFDFPILRQAFEKLNIELPQSLTCVDSLRAFMEIDDTQQ 175
            ..:.:::...|.|......|:.|:.                         |:..||.||:....|
Human   127 RVSLRVLSERLLHKSIQNSLLGHSS-------------------------VEDARATMELYQISQ 166

  Fly   176 KETSQLKVP 184
            :..::..:|
Human   167 RIRARRGLP 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 22/108 (20%)
TREX1_2 20..173 CDD:99839 27/126 (21%)
ISG20NP_001290162.1 DnaQ_like_exo 8..163 CDD:415823 27/125 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.