DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and Isg20l2

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001007742.1 Gene:Isg20l2 / 361977 RGDID:1359413 Length:369 Species:Rattus norvegicus


Alignment Length:402 Identity:72/402 - (17%)
Similarity:114/402 - (28%) Gaps:186/402 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PNDAVAEHAEEQPKISTFAVLDLETTNLPAYRNNRVSITEL--CIYAFEAALLKKKKKEQDQDEQ 65
            |...|::...|.||....:.:|              ||:::  |:...:.|...|:..||.:|::
  Rat    46 PPSKVSKLNSEPPKKGETSRVD--------------SISKILSCLKKKKEAAASKRDSEQSKDKK 96

  Fly    66 QEL----PAAPRVLHKLNVLFQPSMVVDPEAERITGLSNYLLERESQLDTDAAQLIVSFLKHLPS 126
            ..|    ||             ||...|....:|                   .|:..|...||.
  Rat    97 ASLSWLTPA-------------PSKKTDSVVAKI-------------------DLLGEFQSALPK 129

  Fly   127 PVCLVAHNGWGFDFPILRQAFEKLNIELP--QSLTCVDSLRAFMEIDDTQQKETSQLKVP---ND 186
            |                ::..:|...:.|  :.:...:|.:       ||.|:....|.|   |.
  Rat   130 P----------------KRRTQKKGSKKPLKKKIATENSTQ-------TQSKDKGSNKKPLKKNA 171

  Fly   187 VQEIIPELKPKQNTETCLKEPE----------------------------AVVN----------- 212
            ||. ..:.:|:   :.|.|.|:                            ::||           
  Rat   172 VQN-STQAQPE---DKCPKVPQSLPRKMVAIDCEMVGTGPKGRVSSLARCSIVNYNGDVLYDEYI 232

  Fly   213 ------IDWRTR----------NET---TPNRPIL-----------------KPTEAFAKRKLLR 241
                  :|:|||          |.|   |....||                 |..:.|..:.|.|
  Rat   233 RPPCYIVDYRTRWSGIRKCHMVNATPFKTARSQILKILSGKVVVGHAIHNDYKALQYFHPKSLTR 297

  Fly   242 DGDEDDLEEQTPPKRKPDEFRSRRQLFSGCKCAENKRYPPRGVYNLESLYTRIFK---IPALSAH 303
            |..:..|     ..||.|             |.||.      ..:|:.|..::..   ...||.|
  Rat   298 DTSQIPL-----LNRKAD-------------CPENV------TLSLKHLTKKLLSRDIQTGLSGH 338

  Fly   304 QAEADVVMTTKL 315
            .:..|...|.:|
  Rat   339 SSVEDAQATLEL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 22/141 (16%)
TREX1_2 20..173 CDD:99839 24/160 (15%)
Isg20l2NP_001007742.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..68 6/35 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..107 8/39 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 125..188 17/89 (19%)
ISG20 196..352 CDD:99852 31/179 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.