Sequence 1: | NP_001285571.1 | Gene: | CG3165 / 33503 | FlyBaseID: | FBgn0031484 | Length: | 351 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_610427.2 | Gene: | PAN2 / 35893 | FlyBaseID: | FBgn0033352 | Length: | 1241 | Species: | Drosophila melanogaster |
Alignment Length: | 197 | Identity: | 37/197 - (18%) |
---|---|---|---|
Similarity: | 63/197 - (31%) | Gaps: | 77/197 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MAPNDAVAEHAEEQPKISTFAVLDLETTNLPAYRNNRVSITELCIYAFEAALLKKKKKEQDQDEQ 65
Fly 66 QELPAAPRVLHKLNVLFQPSMVVDPEAERITGLSNYLLERESQLDTDAAQLIVSFLKHLPSPVCL 130
Fly 131 VAHNGWGFDFPILRQAFEKLNIELPQSLT----------CVDSLRAFMEIDDTQQKETSQLKVPN 185
Fly 186 DV 187 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3165 | NP_001285571.1 | DnaQ | 19..>155 | CDD:223916 | 21/135 (16%) |
TREX1_2 | 20..173 | CDD:99839 | 28/162 (17%) | ||
PAN2 | NP_610427.2 | WD40 | 63..>270 | CDD:330360 | |
WD40 repeat | 148..183 | CDD:293791 | |||
WD40 repeat | 187..221 | CDD:293791 | |||
WD40 repeat | 227..273 | CDD:293791 | |||
WD40 repeat | 278..314 | CDD:293791 | |||
UCH_1 | 505..940 | CDD:315986 | 37/197 (19%) | ||
zf-CCCH_2 | 799..816 | CDD:317060 | 4/16 (25%) | ||
PAN2_exo | 1036..1209 | CDD:99846 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0847 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |