DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and prage

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster


Alignment Length:257 Identity:51/257 - (19%)
Similarity:85/257 - (33%) Gaps:64/257 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 APNDAVAEHAEEQPKISTFAVLDLETTNLPAYRNNRVSITELCIYAFEAALLKKKKKEQDQDEQQ 66
            :|..:....|...|..|        .|:.|....||..|        ||||  :.::||:...| 
  Fly   396 SPTSSATTSATSSPTNS--------PTSYPRANGNRKRI--------EAAL--EWRREQELGRQ- 441

  Fly    67 ELPAAPRVLHKLNVLFQPSMVVDPEAERITGLSNYLLERESQLDTDAAQLIVSFLKHLPS----- 126
                      ..|.|..|                  |.:..||:.|...::....:|:..     
  Fly   442 ----------NANFLVPP------------------LRQYEQLEFDDKTVVQQLRRHIIDNHLLR 478

  Fly   127 ----PVCLVAHNGWGFDFPIL-RQAFEKLNIELPQSLTCV---DSL--RAFMEI-DDTQQKETSQ 180
                ||..|.|.|....|..: ..:|.....|..|::|.:   |.|  ||..|: :.|....:|.
  Fly   479 VYGFPVDSVVHEGAIEIFKCMPHMSFAAALAETAQAVTVINYHDGLTNRAEEEVANSTDSGNSSP 543

  Fly   181 LKVPNDVQEIIPELKPKQNTETCLKEPEAVVNIDWRTRNETTPNRPILKPTEAFAKRKLLRD 242
            ..:.::........:.:.:..:.....||.:.::.:..:.....|.:.||. |..||..|.|
  Fly   544 QSLDSESGGEWSGSECESSNSSSSSAGEAALGLELKYCHFVPVERSLSKPC-ARCKRHFLVD 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 28/145 (19%)
TREX1_2 20..173 CDD:99839 35/168 (21%)
prageNP_001188528.1 PH-like <614..650 CDD:302622
DnaQ 675..>837 CDD:223916
REX1_like 686..837 CDD:99848
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.