DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and Trex2

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001101050.1 Gene:Trex2 / 309275 RGDID:1562245 Length:236 Species:Rattus norvegicus


Alignment Length:333 Identity:78/333 - (23%)
Similarity:116/333 - (34%) Gaps:109/333 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EQPKISTFAVLDLETTNLPAYRNNRVSITELCIYAFEAALLKKKKKEQDQDEQQELPAAPRVLHK 77
            |..:..||..||||.|.||   |....|.|:.::|...:.|    :..::|:...| ..||||.|
  Rat     3 EPLRAETFVFLDLEATGLP---NMDPEIAEISLFAVHRSSL----ENPERDDSGSL-VLPRVLDK 59

  Fly    78 LNVLFQPSMVVDPEAERITGLSNYLLE--RESQLDTDAAQLIVSFLKHLPSPVCLVAHNGWGFDF 140
            |.:...|......:|..|||||:..|.  |::..:....:.:..||.....|:|||||||:.:||
  Rat    60 LTLCMCPERPFTAKASEITGLSSEGLMNCRKAAFNDAVVRTLQGFLSRQEGPICLVAHNGFDYDF 124

  Fly   141 PILRQAFEKLNIELPQSLTCVDSLRAFMEIDDTQQKETSQLKVPNDVQEIIPELKPKQNTETCLK 205
            |:|....::|...||:...|:|:|.|...:|......|                           
  Rat   125 PLLCTELQRLGAHLPRDTVCLDTLPALRGLDRVHSHGT--------------------------- 162

  Fly   206 EPEAVVNIDWRTRNETTPNRPILKPTEAFAKRKLLRDGDEDDLEEQTPPKRKPDEFRSRRQLFSG 270
                                                                             
  Rat   163 ----------------------------------------------------------------- 162

  Fly   271 CKCAENKRYPPRGVYNLESLYTRIFKIPALSAHQAEADVVMTTKLIQHYGIDFLAFAEEQAIPFQ 335
                   |...|..|:|.||:.|.|:....:||.||.||.....:..|...:.||:|:|||..:.
  Rat   163 -------RAQGRKSYSLASLFHRYFQAEPSAAHSAEGDVNTLLLIFLHRAPELLAWADEQARSWA 220

  Fly   336 QVVPLGSP 343
            .:.|:..|
  Rat   221 HIEPMYVP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 46/137 (34%)
TREX1_2 20..173 CDD:99839 52/154 (34%)
Trex2NP_001101050.1 TREX1_2 10..204 CDD:99839 67/300 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334848
Domainoid 1 1.000 122 1.000 Domainoid score I5518
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I4611
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1365966at2759
OrthoFinder 1 1.000 - - FOG0003419
OrthoInspector 1 1.000 - - otm45985
orthoMCL 1 0.900 - - OOG6_108068
Panther 1 1.100 - - O PTHR13058
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4891
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.