DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and C05C8.5

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_504838.1 Gene:C05C8.5 / 179116 WormBaseID:WBGene00015462 Length:594 Species:Caenorhabditis elegans


Alignment Length:276 Identity:53/276 - (19%)
Similarity:95/276 - (34%) Gaps:95/276 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPNDAV-----AEHAEEQPKISTFAVLDL-----ETTNLPAYRNNRVSITEL------------ 43
            :.|.||:     .||..:..|::....||:     .|.:...:||:..::|||            
 Worm   294 LLPPDAILVGHSLEHDLQAMKMTHPFCLDVGHVLNYTNSNTEFRNSLKNLTELFLGAQIQSEFGH 358

  Fly    44 CIY-----AFEAALLKKKK-----------------KEQDQDEQQELPAAPRVLHKLNVLFQPSM 86
            |.|     |...|.||.:|                 |.....|::.:.||...........||::
 Worm   359 CSYEDAWAAMRLAQLKLEKGLMFGNVSFGWKYSEYAKNNGAVEKKIVTAAEITSKPCTDCSQPTV 423

  Fly    87 VVDPEAE------------------RITGLSNYLLERESQLDTD---AAQLIVSFLK--HLPSPV 128
            |....|.                  .|:...::  ..:..||.|   .|..|.::||  .:.|.:
 Worm   424 VACTVANCRCRFVSTPSKCVHCVKIGISAQGDF--HWQDTLDVDHEKKASPIGNYLKKDKMKSVM 486

  Fly   129 CLVAHNGWGFDF------PILRQAFEKLNIELPQSLTCVDSLRAFM-------------EIDDTQ 174
            |       .||.      ||.::...||:...|.....|:|:.:.|             :|:..:
 Worm   487 C-------AFDTAILDCPPISKKVRSKLHSSFPSYNGFVNSVASEMLNDSVILVEIDKEKIEPLE 544

  Fly   175 QKETSQLKVPNDVQEI 190
            :.::.|.:||::.:.:
 Worm   545 ETDSEQGEVPDNAEAL 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 39/203 (19%)
TREX1_2 20..173 CDD:99839 44/233 (19%)
C05C8.5NP_504838.1 REX1_like 222..372 CDD:99848 17/77 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.