DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and isg20

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_003201484.2 Gene:isg20 / 100534720 ZFINID:ZDB-GENE-100422-17 Length:338 Species:Danio rerio


Alignment Length:125 Identity:24/125 - (19%)
Similarity:41/125 - (32%) Gaps:43/125 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 HKLNVLF---QPSMVVDP----------EAER-----ITGLSNYLLERESQLDTDAAQLIVSFLK 122
            |.||||:   ||.|:.|.          :..:     :..|:..||.|..|:|......:...|.
Zfish   222 HDLNVLYISVQPHMIRDTCSCVLLRQLYDVNQNCNISLKKLAQKLLNRTIQVDRQGHCSVEDALS 286

  Fly   123 HLPSPVCLVAHNGWGFDFPILRQAFEKLNIELPQSLTCVDSLRAFMEIDDTQQKETSQLK 182
            .|                    ..::.:..:...::.|.||     ..:.:||...:.||
Zfish   287 AL--------------------DLYKLVEDQWENNILCQDS-----NAEQSQQFSNNSLK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 17/96 (18%)
TREX1_2 20..173 CDD:99839 20/114 (18%)
isg20XP_003201484.2 ISG20 136..292 CDD:99852 17/89 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.