DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and trex2

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_004916766.1 Gene:trex2 / 100488944 XenbaseID:XB-GENE-921554 Length:230 Species:Xenopus tropicalis


Alignment Length:326 Identity:86/326 - (26%)
Similarity:120/326 - (36%) Gaps:111/326 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ISTFAVLDLETTNLPAYRNNRVSITELCIYAFEAALLKKKKKEQDQDEQQELPAAPRVLHKLNVL 81
            :.:|..||||.|.|   ..|...|||||:.|...:.|  :..|.||.|.|    .||||.||.:.
 Frog     5 VKSFVFLDLEATGL---NYNLPKITELCLVAVHVSSL--ENPETDQSEVQ----LPRVLDKLCLC 60

  Fly    82 FQPSMVVDPEAERITGLSNYLLE--RESQLDTDAAQLIVSFLKHLPSPVCLVAHNGWGFDFPILR 144
            ..|...:..||..||||||..|.  .:...:.:..||:..||.....|||||||||..:|||:|:
 Frog    61 VDPKKPITKEACNITGLSNEKLANCEKPCFNLNLVQLVKEFLNRQAQPVCLVAHNGLFYDFPLLK 125

  Fly   145 QAFEKLNIELPQSLTCVDSLRAFMEIDDTQQKETSQLKVPNDVQEIIPELKPKQNTETCLKEPEA 209
            ..|::.|.|||.||.|:|||:||.::  :||                                  
 Frog   126 AEFQQQNEELPGSLLCLDSLKAFRQL--SQQ---------------------------------- 154

  Fly   210 VVNIDWRTRNETTPNRPILKPTEAFAKRKLLRDGDEDDLEEQTPPKRKPDEFRSRRQLFSGCKCA 274
                                                         .|:..||             
 Frog   155 ---------------------------------------------DRRHQEF------------- 161

  Fly   275 ENKRYPPRGVYNLESLYTRIFKIPALSAHQAEADVVMTTKLIQHYGIDFLAFAEEQAIPFQQVVP 339
                  .:|.:.|..||.|.|....:.:|.||.||:...|:..:...:.|..|......:.::.|
 Frog   162 ------TKGSHTLTELYRRSFGKEPIDSHYAEGDVLTLIKVFMYKASELLEMANSLYKRWSEINP 220

  Fly   340 L 340
            :
 Frog   221 M 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 56/137 (41%)
TREX1_2 20..173 CDD:99839 66/154 (43%)
trex2XP_004916766.1 TREX1_2 8..200 CDD:99839 83/300 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003419
OrthoInspector 1 1.000 - - oto104746
Panther 1 1.100 - - O PTHR13058
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4891
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.