DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and rexo4

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_002665913.1 Gene:rexo4 / 100333127 ZFINID:ZDB-GENE-050411-124 Length:418 Species:Danio rerio


Alignment Length:105 Identity:22/105 - (20%)
Similarity:45/105 - (42%) Gaps:25/105 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 FMEIDDTQQKETSQLKVPNDVQEIIPELKPKQNTE--TCLKEPEAVVNIDWRTRNETTPNRPILK 229
            |...:..::|||.:.|..|      |.:.|..:.:  :|          :||...:|.|..| .|
Zfish    34 FFATEPAKKKETQKPKSAN------PFIMPPTDGQDYSC----------NWRKLLQTLPPNP-EK 81

  Fly   230 PTEAFAKRKLLRDGDEDDLEEQTPPK--RKPDE-FRSRRQ 266
            ..|...:   ::|.:.:..::.:.||  .||:: |:..::
Zfish    82 KNEGTGQ---IKDANVNGKQKPSSPKDSHKPEKRFKKAKE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916
TREX1_2 20..173 CDD:99839 1/5 (20%)
rexo4XP_002665913.1 DnaQ 231..>384 CDD:223916
REX4_like 234..385 CDD:99847
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.