DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and rexo4

DIOPT Version :10

Sequence 1:NP_608732.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_002665913.1 Gene:rexo4 / 100333127 ZFINID:ZDB-GENE-050411-124 Length:418 Species:Danio rerio


Alignment Length:105 Identity:22/105 - (20%)
Similarity:45/105 - (42%) Gaps:25/105 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 FMEIDDTQQKETSQLKVPNDVQEIIPELKPKQNTE--TCLKEPEAVVNIDWRTRNETTPNRPILK 229
            |...:..::|||.:.|..|      |.:.|..:.:  :|          :||...:|.|..| .|
Zfish    34 FFATEPAKKKETQKPKSAN------PFIMPPTDGQDYSC----------NWRKLLQTLPPNP-EK 81

  Fly   230 PTEAFAKRKLLRDGDEDDLEEQTPPK--RKPDE-FRSRRQ 266
            ..|...:   ::|.:.:..::.:.||  .||:: |:..::
Zfish    82 KNEGTGQ---IKDANVNGKQKPSSPKDSHKPEKRFKKAKE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_608732.1 TREX1_2 20..173 CDD:99839 1/5 (20%)
rexo4XP_002665913.1 REX4_like 234..385 CDD:99847
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.