DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and Trex1

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001020160.1 Gene:Trex1 / 100049583 RGDID:1311998 Length:316 Species:Rattus norvegicus


Alignment Length:327 Identity:79/327 - (24%)
Similarity:116/327 - (35%) Gaps:108/327 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ISTFAVLDLETTNLPAYRNNRVSITELCIYAFEAALLKKKKKEQDQDEQQELPAAPRVLHKLNVL 81
            :.|...||||.|.||   .::..|||||:.|.....|:.....:.|  ...:|..|||:.||::.
  Rat    11 MQTLIFLDLEATGLP---YSQPKITELCLLAVHRHALENSSMSEGQ--PPPVPKPPRVVDKLSLC 70

  Fly    82 FQPSMVVDPEAERITGLSNYLLER--ESQLDTDAAQLIVSFLKHLPSPVCLVAHNGWGFDFPILR 144
            ..|.......|..||||:...||.  ..:.:.:.|.|:..||:..|.|.|||||||..:|||:|:
  Rat    71 IAPGKPCSSGASEITGLTTAGLEAHGRQRFNDNLATLLQVFLQRQPQPCCLVAHNGDRYDFPLLQ 135

  Fly   145 QAFEKLNIELPQSLT-CVDSLRAFMEIDDTQQKETSQLKVPNDVQEIIPELKPKQNTETCLKEPE 208
            .....|::..|...| ||||:.|              ||.                         
  Rat   136 AELASLSVISPLDGTFCVDSIAA--------------LKT------------------------- 161

  Fly   209 AVVNIDWRTRNETTPNRPILKPTEAFAKRKLLRDGDEDDLEEQTPPKRKPDEFRSRRQLFSGCKC 273
                                                   ||:.:.|                   
  Rat   162 ---------------------------------------LEQASSP------------------- 168

  Fly   274 AENKRYPPRGVYNLESLYTRIFKIPALSAHQAEADVVMTTKLIQHYGIDFLAFAEEQAIPFQQVV 338
               ..:.||..|:|.|:|||::......:|.||.||:....:.|......|.:.::.|.||..:.
  Rat   169 ---SEHGPRKSYSLGSIYTRLYGQAPTDSHTAEGDVLALLSICQWKPQALLQWVDKHARPFSTIK 230

  Fly   339 PL 340
            |:
  Rat   231 PM 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 48/137 (35%)
TREX1_2 20..173 CDD:99839 54/155 (35%)
Trex1NP_001020160.1 TREX1_2 14..211 CDD:99839 73/301 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334847
Domainoid 1 1.000 122 1.000 Domainoid score I5518
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I4611
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1365966at2759
OrthoFinder 1 1.000 - - FOG0003419
OrthoInspector 1 1.000 - - otm45985
orthoMCL 1 0.900 - - OOG6_108068
Panther 1 1.100 - - LDO PTHR13058
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4891
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.