powered by:
Protein Alignment gammaTub23C and LOC101732615
DIOPT Version :9
Sequence 1: | NP_476804.1 |
Gene: | gammaTub23C / 33501 |
FlyBaseID: | FBgn0260639 |
Length: | 475 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_031750698.1 |
Gene: | LOC101732615 / 101732615 |
-ID: | - |
Length: | 75 |
Species: | Xenopus tropicalis |
Alignment Length: | 73 |
Identity: | 46/73 - (63%) |
Similarity: | 56/73 - (76%) |
Gaps: | 0/73 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 382 MLANHTSICSLFERALNQYDKLRKRGAFLDQFRREDIFKDDLNELDESRETVDCLVQEYEAATRE 446
|:||||:|.|||||...||||||||.|||:||.:||||||:.:|||.|||.|..|:.||.||||.
Frog 1 MMANHTNISSLFERTCRQYDKLRKREAFLEQFHKEDIFKDNFDELDNSREIVQQLIDEYHAATRP 65
Fly 447 DYMQFSVK 454
||:.:..:
Frog 66 DYISWGTQ 73
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D267298at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.