DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTub23C and LOC101732615

DIOPT Version :9

Sequence 1:NP_476804.1 Gene:gammaTub23C / 33501 FlyBaseID:FBgn0260639 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_031750698.1 Gene:LOC101732615 / 101732615 -ID:- Length:75 Species:Xenopus tropicalis


Alignment Length:73 Identity:46/73 - (63%)
Similarity:56/73 - (76%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 MLANHTSICSLFERALNQYDKLRKRGAFLDQFRREDIFKDDLNELDESRETVDCLVQEYEAATRE 446
            |:||||:|.|||||...||||||||.|||:||.:||||||:.:|||.|||.|..|:.||.||||.
 Frog     1 MMANHTNISSLFERTCRQYDKLRKREAFLEQFHKEDIFKDNFDELDNSREIVQQLIDEYHAATRP 65

  Fly   447 DYMQFSVK 454
            ||:.:..:
 Frog    66 DYISWGTQ 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTub23CNP_476804.1 PLN00222 1..451 CDD:215108 46/68 (68%)
gamma_tubulin 4..440 CDD:276957 38/57 (67%)
LOC101732615XP_031750698.1 Tubulin_FtsZ_Cetz-like <1..59 CDD:415827 38/57 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D267298at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.