DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp1 and SRP40

DIOPT Version :9

Sequence 1:NP_001137776.1 Gene:Rrp1 / 33500 FlyBaseID:FBgn0004584 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_013018.3 Gene:SRP40 / 853967 SGDID:S000001800 Length:406 Species:Saccharomyces cerevisiae


Alignment Length:421 Identity:68/421 - (16%)
Similarity:167/421 - (39%) Gaps:56/421 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRVKAVKKQAEALASEPTDPTPNANGNGVDENADSAAEELKVPAKGKPRARKATKTAVSAENSE 65
            :|::...:|:.|..:|..:..:.:::.:....::.|:       :.|:..:..::.::.|:.:|.
Yeast    11 VPKLSVKEKEIEEKSSSSSSSSSSSSSSSSSSSSSSS-------SSGESSSSSSSSSSSSSSDSS 68

  Fly    66 EVEPQKAPTAAARGKKKQPKDTDENGQMEVVAKPKGRAKKAT---------AEAEPEPK-----V 116
            :....::.::::.........:|.....|..:...|.:..::         :|:|.|.|     .
Yeast    69 DSSDSESSSSSSSSSSSSSSSSDSESSSESDSSSSGSSSSSSSSSDESSSESESEDETKKRARES 133

  Fly   117 DLPAGKATKPRAKKEP-TPAPDEVTSSPPKGRAKAEKPTNAQAKGRKRKELPAEANGGAEEAAEP 180
            |....|.|| :||.|| :.:..|.:||.....:::|..:.:.:.........:::...:|..::.
Yeast   134 DNEDAKETK-KAKTEPESSSSSESSSSGSSSSSESESGSESDSDSSSSSSSSSDSESDSESDSQS 197

  Fly   181 PKQRARKEAVPTLKEQAEPGTISKEKVQKAETAAKRARGTKRLADSEIAAALDEPEVDEVPPKAA 245
            ....:..::      .::..:.|.:....:::::..:..:.. :||:..::.|..........::
Yeast   198 SSSSSSSDS------SSDSDSSSSDSSSDSDSSSSSSSSSSD-SDSDSDSSSDSDSSGSSDSSSS 255

  Fly   246 SKRAKKGKMVEPSPETVGDFQS-VQEEVESPPKTAAAPKKRAKKT--TNGETAVELEPKTKAK-- 305
            |..:........|.::..|..| ...|:|:  |.|.|.:.:|::|  ::.|:.......:.|.  
Yeast   256 SDSSSDESTSSDSSDSDSDSDSGSSSELET--KEATADESKAEETPASSNESTPSASSSSSANKL 318

  Fly   306 --PTKQRAKKEGKEPAPGKKQKKSADKENGVVEEEAKPSTET--KPAKGR--KKAPVKAEDVEDI 364
              |......|||:     :|.....|:..  :..||...|:.  |.|.|.  :||..|...|...
Yeast   319 NIPAGTDEIKEGQ-----RKHFSRVDRSK--INFEAWELTDNTYKGAAGTWGEKANEKLGRVRGK 376

  Fly   365 EEAAEESKPARGRKKAAAKAEEPDVDEESGS 395
            :....::|..||..:..:      :..||||
Yeast   377 DFTKNKNKMKRGSYRGGS------ITLESGS 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp1NP_001137776.1 RecX 15..>217 CDD:294607 26/216 (12%)
RR_TM4-6 <314..>388 CDD:283990 17/77 (22%)
Ape1-like_AP-endo 454..704 CDD:197321
SRP40NP_013018.3 SRP40_C 334..404 CDD:398615 18/76 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2992
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.