DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp1 and AT3G48425

DIOPT Version :9

Sequence 1:NP_001137776.1 Gene:Rrp1 / 33500 FlyBaseID:FBgn0004584 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_566904.2 Gene:AT3G48425 / 824001 AraportID:AT3G48425 Length:364 Species:Arabidopsis thaliana


Alignment Length:349 Identity:91/349 - (26%)
Similarity:151/349 - (43%) Gaps:64/349 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 MLNFCFPATKKAKKAETKTTVTLDK---DAFALPADKEFN--LKICSWNVAGLRAWLKKDGLQ-- 474
            |..|..|..|:...|..|..::.:|   |...:..:|..|  .|..:||.......:|.|..|  
plant     1 MKRFFKPIEKENSPAAKKPCLSPEKRDGDGDGVEEEKNQNEPSKFMTWNANSFLLRVKNDWSQFS 65

  Fly   475 -LIDLEEPDIFCLQETKCA----------NDQLPEE----------VTR------LPGYHPYWLC 512
             .:...:||:..:||.:..          :::|.::          :||      ...|..:|..
plant    66 KFVSDFDPDVIAIQEVRMPAAGGKGKPKNHEELSDDTKVLREEKQILTRALSSPPFGNYGVWWSL 130

  Fly   513 MPGGYAGVAIYSK--IMPIHVEYGIGN--EEFDDVGRMITAEYEKFYLINVYVPNSGRKLVN--L 571
            ....|||.|:..|  ..|..|.:.:..  .:.:..||:|.||:|.|.|:|.|.||:|.|...  .
plant   131 ADSKYAGTALLVKKCFKPRKVYFNLDKLASKHEPDGRVILAEFETFRLLNTYSPNNGWKDEENAF 195

  Fly   572 EPRMRWEKLFQAYVKKLDALKPVVICGDMNVSHMPIDLENP---------------KNNTKNAGF 621
            :.|.:|:|....::.|... ||::.|||:||||..||:.:|               |.:....||
plant   196 QRRRKWDKRIVEFLNKTSD-KPLIWCGDLNVSHEEIDVSHPEFFATAKLNGYVPPNKEDCGQPGF 259

  Fly   622 TQEERDKMTELLGLG-FVDTFRHLYPDRKGAYTF-WTYMANARARNVGWRLDYCLVSERFVPKVV 684
            |..||.:....:..| .||.:|:|:.:::....| |:.....:.|....|:||.||||:...::|
plant   260 TPSERGRFGATIKEGRLVDAYRYLHKEQEMESGFSWSGNPIGKYRGKRMRIDYFLVSEQLKDRIV 324

  Fly   685 EHEIRSQCL------GSDHCPITI 702
            ..::..:.:      ||||||:|:
plant   325 SCKMHGRGIELEGFHGSDHCPVTL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp1NP_001137776.1 RecX 15..>217 CDD:294607
RR_TM4-6 <314..>388 CDD:283990
Ape1-like_AP-endo 454..704 CDD:197321 81/307 (26%)
AT3G48425NP_566904.2 Ape1-like_AP-endo 44..350 CDD:197321 81/306 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0708
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005771
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22748
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.