DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp1 and Nolc1

DIOPT Version :9

Sequence 1:NP_001137776.1 Gene:Rrp1 / 33500 FlyBaseID:FBgn0004584 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_001034441.1 Gene:Nolc1 / 70769 MGIID:1918019 Length:702 Species:Mus musculus


Alignment Length:526 Identity:125/526 - (23%)
Similarity:200/526 - (38%) Gaps:148/526 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRVKAVKKQAEALASEPTDPTPNANGNGVDENADSAAEELKVPAKGKPRARKATKTAVSAE---- 62
            |:.|||:..|:...|..:|.         |.::||::|| :.|...||:|..|.|....||    
Mouse   157 PQAKAVRPPAKKAESSESDS---------DSDSDSSSEE-ETPQTQKPKAAVAAKAQTKAEAKPG 211

  Fly    63 ----------------------NSEEVEPQKAPTAAARGKKKQPK-------------------- 85
                                  :|::.|.:|  .|||..||..||                    
Mouse   212 TPAKAQPKVANGKAAASSSSSSSSDDSEEEK--KAAAPPKKTVPKKQVVAKAPVKVAAAPTQKSS 274

  Fly    86 ------DTDENGQMEVVAKPKG--------------------RAKKATAEAEPEPKVDLPAGKAT 124
                  ..:|.||.:.:.|..|                    ..|||.|:.:|....|..:..:.
Mouse   275 SSEDSSSEEEEGQRQPMKKKAGPYSSVPPPSVPLPKKSPGTQAPKKAAAQTQPADSSDDSSDDSD 339

  Fly   125 KPRAKKEPTPAPDEVTSSPPKG---RAKAEKPTNAQAKGRKRKELPAE--ANGGAEEAAEPPKQR 184
            ....:::..||...|:.:|.|.   :.|||..:::........|.||:  :...:.:.|..||..
Mouse   340 SSSEEEKKPPAKTVVSKTPAKAAPVKKKAESSSDSSDSDSSEDEAPAKPVSTTKSPKPAVTPKPS 404

  Fly   185 ARKEAVPTLKEQAEPGTISKEKVQKAETAAKRARGTKRLADSEIAAALDEPEVDE---VPPKAAS 246
            |.| ||.|.|:.|  |:..|.:.:||:::          :..|.:::.:|.|..:   ..|||  
Mouse   405 AAK-AVTTPKQPA--GSNQKPQSRKADSS----------SSEEESSSSEEEEASKKSATTPKA-- 454

  Fly   247 KRAKKGKMVEPSPETVGDF-----QSVQEEVESPPKTAA------------APKKRAK------- 287
            |...|....:.:|:..||.     .|..||.|..||..|            ||.|:|:       
Mouse   455 KVTAKAAPAKQAPQAAGDSSSDSDSSSSEEEEKTPKPPAKKKAAGGAVSTPAPGKKAEAKSSSSS 519

  Fly   288 KTTNGETAVELEPKTKAKPT--KQRAKKEGKEPAP--GKKQKKSADKENGVVEEEAKPSTETKPA 348
            .:::.|.:.|.|.|.|.|.|  |.:|.|....||.  ||..|:|.::|.....||.|.:..|||.
Mouse   520 SSSSSEDSSEEEKKKKPKATTPKIQASKANGTPASLNGKAAKESEEEEEEEETEEKKKAAGTKPG 584

  Fly   349 KGRKKAPVKAEDVEDIEEAAEES--------KPARGRKKAAA-----KAEEPDVDEESGSKSMLA 400
            .|:|:...:..|.....:|.:..        |..:|.::|::     :.||.:||......|..|
Mouse   585 SGKKRKQNETADEATTPQAKKVKLETPNTFPKRKKGERRASSPFRRVREEEIEVDSRVADNSFDA 649

  Fly   401 EQSGCG 406
            ::...|
Mouse   650 KRGAAG 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp1NP_001137776.1 RecX 15..>217 CDD:294607 61/278 (22%)
RR_TM4-6 <314..>388 CDD:283990 22/88 (25%)
Ape1-like_AP-endo 454..704 CDD:197321
Nolc1NP_001034441.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..635 118/504 (23%)
Nuclear localization signal. /evidence=ECO:0000255 69..83
11 X 12 AA approximate repeats of an acidic serine cluster. /evidence=ECO:0000250|UniProtKB:Q14978 85..566 104/435 (24%)
Interaction with RPA194. /evidence=ECO:0000250|UniProtKB:Q14978 215..390 32/176 (18%)
Nuclear localization signal. /evidence=ECO:0000255 392..590 61/212 (29%)
Nuclear localization signal. /evidence=ECO:0000255 604..620 1/15 (7%)
SRP40_C 627..693 CDD:309939 7/29 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2992
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.