DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp1 and apex2

DIOPT Version :9

Sequence 1:NP_001137776.1 Gene:Rrp1 / 33500 FlyBaseID:FBgn0004584 Length:706 Species:Drosophila melanogaster
Sequence 2:XP_031746216.1 Gene:apex2 / 448512 XenbaseID:XB-GENE-1012054 Length:546 Species:Xenopus tropicalis


Alignment Length:336 Identity:101/336 - (30%)
Similarity:150/336 - (44%) Gaps:85/336 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 TTVTLDKDAFALPADKEF-NLKICSWNVAGLRAWLKKDGL-QLIDLEEPDIFCLQETKCANDQLP 497
            |||.:::.  :.|.|... ::||.|||:.|:||  .:.|| :.:|..:.||.||||||...|.|.
 Frog    12 TTVGVNEK--STPGDATAGSMKIVSWNINGIRA--TRVGLKETLDSLDADIICLQETKVTRDLLD 72

  Fly   498 EEVTRLPGYHPYWLCMPG--GYAGVAIY--SKIMPIHVEYGI--------------GN-EEF--- 540
            |....:.||:.|:....|  ||:|||.:  |...|...|.|:              || |||   
 Frog    73 EPSAIVEGYNSYFSFSRGRSGYSGVATFCKSSTTPWAAEEGLSGMLCNHTGSIGCYGNTEEFLEE 137

  Fly   541 -----DDVGRMITAEY---------EKFYLINVYVPNSG-----RKLVNLEPRMRWEKLFQAYVK 586
                 |..||.:..::         |...:||||.|.:.     ||..    ::|:.:|.|.   
 Frog   138 ELQSLDQEGRAVLTQHRIRNCEGKEETLTVINVYCPRADPEKPERKTY----KLRFYRLLQT--- 195

  Fly   587 KLDALKP----VVICGDMNVSHMPI------DLENPKNNTKNAGFTQ--------EERDKMTELL 633
            :.:|:..    |:|.||:|.||.|:      |||..:.|.......|        ::.|..|...
 Frog   196 RAEAILQKGGHVIILGDVNTSHRPLDHCDPTDLETFEENPGRQWLNQFLGDPVPSQKGDSETGTP 260

  Fly   634 GLG----FVDTFRHLYPDRKGAYTFWTYMANARARNVGWRLDYC-----LVSERFVPKVVEHEIR 689
            ..|    |.|:||:.:|.::.|:|.|...:.||..|.|.|:||.     ||...|:..::..|:.
 Frog   261 PSGGSGRFYDSFRYFHPTQRNAFTCWCSASGARQTNYGTRIDYILGNSELVEREFLDSIIMPEVE 325

  Fly   690 SQCLGSDHCPI 700
                ||||||:
 Frog   326 ----GSDHCPV 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp1NP_001137776.1 RecX 15..>217 CDD:294607
RR_TM4-6 <314..>388 CDD:283990
Ape1-like_AP-endo 454..704 CDD:197321 96/316 (30%)
apex2XP_031746216.1 Ape2-like_AP-endo 31..336 CDD:197322 96/315 (30%)
zf-GRF 490..537 CDD:399670
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.