DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp1 and apex2

DIOPT Version :9

Sequence 1:NP_001137776.1 Gene:Rrp1 / 33500 FlyBaseID:FBgn0004584 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_956440.1 Gene:apex2 / 393115 ZFINID:ZDB-GENE-040426-835 Length:558 Species:Danio rerio


Alignment Length:317 Identity:96/317 - (30%)
Similarity:145/317 - (45%) Gaps:80/317 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 LKICSWNVAGLRAWLKKDGL-QLIDLEEPDIFCLQETKCANDQLPEEVTRLPGYHPYWLCMPG-- 515
            :||.:||:.|:|.:  |:|: :::|..:.||.|:||||...|.|.|:...:.||:.|:....|  
Zfish     1 MKIVTWNINGIRTF--KNGIKKILDSFDADIICVQETKVTRDLLDEKTAIVDGYNSYFSFSRGRS 63

  Fly   516 GYAGVAIYSK--IMPIHVEYG-----------IG---------NEE---FDDVGRMITAEY---- 551
            ||:|||.|.|  ..|...|.|           ||         :||   .|:.||.:..::    
Zfish    64 GYSGVATYCKDAATPFLAEEGLTGLLSNQGAVIGCYGDQVELTSEELLALDNEGRAVITQHHFIG 128

  Fly   552 ----EKFYLINVYVPNSG-----RKLVNLEPRMRWEKLFQAYVKK-LDALKPVVICGDMNVSHMP 606
                :|..:||||.|.:.     ||    |.::::.:|.|...:. |.:...|:|.||:|.||.|
Zfish   129 QDGLQKLTVINVYCPRADPDKPERK----EFKLQFYRLLQCRAEAILSSGSHVIILGDVNTSHRP 189

  Fly   607 ID----------LENP------------KNNTKNAGFTQEERDKMTELLGLG-FVDTFRHLYPDR 648
            ||          .:||            ..|::|.....|..:...|....| |||:||:.:|.|
Zfish   190 IDHCDPDDVDNFEDNPGRKWLDQFLFETAENSENGNAADEPAEDFQESASGGKFVDSFRYFHPKR 254

  Fly   649 KGAYTFWTYMANARARNVGWRLDY-----CLVSERFVPKVVEHEIRSQCLGSDHCPI 700
            ..|:|.|:.:..||..|.|.|:||     .||...|:...:..|:.    ||||||:
Zfish   255 SNAFTCWSTLTGARQTNYGTRIDYIFSNHSLVKTFFIGVDIMPEVE----GSDHCPV 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp1NP_001137776.1 RecX 15..>217 CDD:294607
RR_TM4-6 <314..>388 CDD:283990
Ape1-like_AP-endo 454..704 CDD:197321 96/317 (30%)
apex2NP_956440.1 Ape2-like_AP-endo 2..311 CDD:197322 96/316 (30%)
zf-GRF 506..557 CDD:284302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0708
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R72
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.