DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp1 and Apex2

DIOPT Version :9

Sequence 1:NP_001137776.1 Gene:Rrp1 / 33500 FlyBaseID:FBgn0004584 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_001073361.1 Gene:Apex2 / 317628 RGDID:1565983 Length:516 Species:Rattus norvegicus


Alignment Length:332 Identity:97/332 - (29%)
Similarity:144/332 - (43%) Gaps:100/332 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 LKICSWNVAGLRAWLKKDGL-------------QLIDLEEPDIFCLQETKCANDQLPEEVTRLPG 505
            |::.|||:.|:|:.|:  ||             :::|..:.||.||||||...|.|.|.:..:.|
  Rat     2 LRVVSWNINGIRSPLQ--GLAGQEPSNSPTALRRVLDELDADIVCLQETKVTRDVLTEPLAIVEG 64

  Fly   506 YHPYWLC--MPGGYAGVAIYSK--IMPIHVEYGI--------------GN-EEF--------DDV 543
            |:.|:..  ...||:|||.:.|  ..|:..|.|:              || :||        |..
  Rat    65 YNSYFSFSRSRSGYSGVATFCKDSATPVAAEEGLSGVFATLNGDIGCYGNTDEFTQEELRVLDSE 129

  Fly   544 GRMITAEY--------EK-FYLINVYVPNSG-RKLVNLEPRMRWEKLFQAYVKKLDAL-KPVVIC 597
            ||....::        || ..|||||.|::. .|...|..:||:.:|.|...:.|.|. ..|:|.
  Rat   130 GRAFLTQHKIRTLEGKEKTLTLINVYCPHADPGKPERLTFKMRFYRLLQIRAEALLAAGSHVIIL 194

  Fly   598 GDMNVSHMPID----------------------LENPKNNT-KNAGFTQEERDKMTELLGLGFVD 639
            ||:|.:|.|||                      |.||.|.. .:.|.               |:|
  Rat   195 GDLNTAHRPIDHCDASSLECFEEDPGRKWMDGLLSNPGNEAGPHIGH---------------FMD 244

  Fly   640 TFRHLYPDRKGAYTFWTYMANARARNVGWRLDY-----CLVSERFVPKVVEHEIRSQCLGSDHCP 699
            :||:.:|.::.|:|.|:.::.||..|.|.||||     .||.:.|....:..|:    :||||||
  Rat   245 SFRYFHPKQQRAFTCWSVVSGARHLNYGSRLDYVLGDRSLVIDTFQASFLLPEV----MGSDHCP 305

  Fly   700 ITIFFNI 706
            :....|:
  Rat   306 VGAVLNV 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp1NP_001137776.1 RecX 15..>217 CDD:294607
RR_TM4-6 <314..>388 CDD:283990
Ape1-like_AP-endo 454..704 CDD:197321 96/328 (29%)
Apex2NP_001073361.1 Ape2-like_AP-endo 3..310 CDD:197322 95/327 (29%)
zf-GRF 463..512 CDD:284302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0708
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.