DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp1 and APEX2

DIOPT Version :9

Sequence 1:NP_001137776.1 Gene:Rrp1 / 33500 FlyBaseID:FBgn0004584 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_055296.2 Gene:APEX2 / 27301 HGNCID:17889 Length:518 Species:Homo sapiens


Alignment Length:317 Identity:100/317 - (31%)
Similarity:146/317 - (46%) Gaps:81/317 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 LKICSWNVAGLRAWLKKDGLQ------------LIDLEEPDIFCLQETKCANDQLPEEVTRLPGY 506
            |::.|||:.|:|..|:....|            ::|..:.||.||||||...|.|.|.:..:.||
Human     2 LRVVSWNINGIRRPLQGVANQEPSNCAAVAVGRILDELDADIVCLQETKVTRDALTEPLAIVEGY 66

  Fly   507 HPYWLCM--PGGYAGVAIYSK--IMPIHVEYGI--------------GN-EEF--------DDVG 544
            :.|:...  ..||:|||.:.|  ..|:..|.|:              || :||        |..|
Human    67 NSYFSFSRNRSGYSGVATFCKDNATPVAAEEGLSGLFATQNGDVGCYGNMDEFTQEELRALDSEG 131

  Fly   545 RMITAEY--------EK-FYLINVYVPNS--GR--KLVNLEPRMRWEKLFQAYVKKLDAL-KPVV 595
            |.:..::        || ..|||||.|::  ||  :||.   :||:.:|.|...:.|.|. ..|:
Human   132 RALLTQHKIRTWEGKEKTLTLINVYCPHADPGRPERLVF---KMRFYRLLQIRAEALLAAGSHVI 193

  Fly   596 ICGDMNVSHMPIDLENPKNNTKNAGFTQEE--RDKMTELL-GLG---------FVDTFRHLYPDR 648
            |.||:|.:|.|||    ..:..|....:|:  |..|..|| .||         |:|::|...|.:
Human   194 ILGDLNTAHRPID----HWDAVNLECFEEDPGRKWMDSLLSNLGCQSASHVGPFIDSYRCFQPKQ 254

  Fly   649 KGAYTFWTYMANARARNVGWRLDY-----CLVSERFVPKVVEHEIRSQCLGSDHCPI 700
            :||:|.|:.:..||..|.|.||||     .||.:.|....:..|:    :||||||:
Human   255 EGAFTCWSAVTGARHLNYGSRLDYVLGDRTLVIDTFQASFLLPEV----MGSDHCPV 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp1NP_001137776.1 RecX 15..>217 CDD:294607
RR_TM4-6 <314..>388 CDD:283990
Ape1-like_AP-endo 454..704 CDD:197321 100/317 (32%)
APEX2NP_055296.2 Ape2-like_AP-endo 3..311 CDD:197322 99/316 (31%)
SPOR <347..>449 CDD:331908
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..407
Required for the colocalization with PCNA in nuclear foci in presence of oxidative-induced DNA damaging agents 390..397
zf-GRF 467..514 CDD:284302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0708
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R72
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.