DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp1 and Apex1

DIOPT Version :9

Sequence 1:NP_001137776.1 Gene:Rrp1 / 33500 FlyBaseID:FBgn0004584 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_033817.1 Gene:Apex1 / 11792 MGIID:88042 Length:317 Species:Mus musculus


Alignment Length:350 Identity:165/350 - (47%)
Similarity:209/350 - (59%) Gaps:56/350 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 PARGRKKAAAKAEEPDVDEESGSKSMLAEQSGCGGAAVLKSLQTMLNFCFPATKKAKKAETKTTV 437
            |.||:|.||...|||..:                                |.|||:|.|..||  
Mouse     2 PKRGKKAAADDGEEPKSE--------------------------------PETKKSKGAAKKT-- 32

  Fly   438 TLDKDAF--------------ALPADKEFNLKICSWNVAGLRAWLKKDGLQLIDLEEPDIFCLQE 488
              :|:|.              ..|:.|...||||||||.|||||:||.||..:..|.|||.||||
Mouse    33 --EKEAAGEGPVLYEDPPDQKTSPSGKSATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQE 95

  Fly   489 TKCANDQLPEEVTRLPGY-HPYWLCMPG---GYAGVAIYSKIMPIHVEYGIGNEEFDDVGRMITA 549
            |||:.::||.|:..|||. |.|| ..|.   ||:||.:.|:..|:.|.||||.||.|..||:|.|
Mouse    96 TKCSENKLPAELQELPGLTHQYW-SAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVA 159

  Fly   550 EYEKFYLINVYVPNSGRKLVNLEPRMRWEKLFQAYVKKLDALKPVVICGDMNVSHMPIDLENPKN 614
            |:|.|.|:..||||:||.||.||.|.||::.|:.::|.|.:.||:|:|||:||:|..|||.|||.
Mouse   160 EFESFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKDLASRKPLVLCGDLNVAHEEIDLRNPKG 224

  Fly   615 NTKNAGFTQEERDKMTELL-GLGFVDTFRHLYPDRKGAYTFWTYMANARARNVGWRLDYCLVSER 678
            |.||||||.:||....||| .:...|:||||||:...||||||||.|||::||||||||.|:|..
Mouse   225 NKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTAYAYTFWTYMMNARSKNVGWRLDYFLLSHS 289

  Fly   679 FVPKVVEHEIRSQCLGSDHCPITIF 703
            .:|.:.:.:|||:.|||||||||::
Mouse   290 LLPALCDSKIRSKALGSDHCPITLY 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp1NP_001137776.1 RecX 15..>217 CDD:294607
RR_TM4-6 <314..>388 CDD:283990 8/14 (57%)
Ape1-like_AP-endo 454..704 CDD:197321 144/254 (57%)
Apex1NP_033817.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 20/91 (22%)
Necessary for interaction with YBX1, binding to RNA, association together with NPM1 to rRNA, endoribonuclease activity on abasic RNA and localization in the nucleoli. /evidence=ECO:0000250 2..32 15/61 (25%)
Nuclear localization signal (NLS). /evidence=ECO:0000250 8..12 2/3 (67%)
Necessary for interaction with NPM1 and for efficient rRNA binding. /evidence=ECO:0000250 22..32 5/9 (56%)
Ape1-like_AP-endo 61..315 CDD:197321 144/254 (57%)
Nuclear export signal (NES). /evidence=ECO:0000250 63..79 13/15 (87%)
Mitochondrial targeting sequence (MTS). /evidence=ECO:0000250 288..317 13/26 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840828
Domainoid 1 1.000 279 1.000 Domainoid score I1677
eggNOG 1 0.900 - - E1_COG0708
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005771
OrthoInspector 1 1.000 - - oto93958
orthoMCL 1 0.900 - - OOG6_101139
Panther 1 1.100 - - LDO PTHR22748
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R72
SonicParanoid 1 1.000 - - X5491
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.