DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ts and DFR1

DIOPT Version :10

Sequence 1:NP_477367.1 Gene:Ts / 33499 FlyBaseID:FBgn0024920 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_014879.1 Gene:DFR1 / 854411 SGDID:S000005762 Length:211 Species:Saccharomyces cerevisiae


Alignment Length:86 Identity:18/86 - (20%)
Similarity:30/86 - (34%) Gaps:23/86 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 GKGIDQLRQVID---TIRNNPSDRRI---------------IMSAWNPLDI-----PKMALPPCH 202
            |:...|:..:.|   ..:.||.|:..               :.|..:|..:     ||:.||...
Yeast   125 GEVYSQIFSITDHWLITKINPLDKNATPAMDTFLDAKKLEEVFSEQDPAQLKEFLPPKVELPETD 189

  Fly   203 CLAQFYVSEKRGELSCQLYQR 223
            |..::.:.||.......||.|
Yeast   190 CDQRYSLEEKGYCFEFTLYNR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TsNP_477367.1 PTZ00164 <33..321 CDD:240299 18/86 (21%)
DFR1NP_014879.1 DHFR 8..208 CDD:238127 15/82 (18%)

Return to query results.
Submit another query.