DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ts and dhfr

DIOPT Version :10

Sequence 1:NP_477367.1 Gene:Ts / 33499 FlyBaseID:FBgn0024920 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_571850.1 Gene:dhfr / 81882 ZFINID:ZDB-GENE-010406-5 Length:190 Species:Danio rerio


Alignment Length:86 Identity:19/86 - (22%)
Similarity:38/86 - (44%) Gaps:11/86 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 GVPFNIASYALLTHMIAHVTGLKPGDFVHTMGDTHVYLNHVEPLKEQLERT--PRPFPKLIIKRQ 292
            |..:..:.::...|::......|..|.|..:|.:.:|       ||.:||:  .|.|...|:|:.
Zfish    88 GAHYLASDFSSALHLLDSGELEKLVDQVWIIGGSSLY-------KEVMERSGHRRLFVTRILKQF 145

  Fly   293 VQD--IEDFRFEDFQIVDYNP 311
            ..|  |.:|..:.::::...|
Zfish   146 DCDTFIPNFDMDKYKLLPEFP 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TsNP_477367.1 PTZ00164 <33..321 CDD:240299 19/86 (22%)
dhfrNP_571850.1 DHFR 5..186 CDD:238127 19/86 (22%)

Return to query results.
Submit another query.