DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp9 and eIF3g2

DIOPT Version :9

Sequence 1:NP_001259974.1 Gene:Rbp9 / 33498 FlyBaseID:FBgn0010263 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_650887.1 Gene:eIF3g2 / 42422 FlyBaseID:FBgn0038796 Length:273 Species:Drosophila melanogaster


Alignment Length:274 Identity:65/274 - (23%)
Similarity:103/274 - (37%) Gaps:57/274 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 PSSESIKGANLYVSGLPKNMTQSDLESLFSPYG---KIITSRILCDNITGLSKGVGFIRFDQRFE 249
            ||:|.|||...||:           |..|:..|   |::.:..:...|  :.|.|...|...:|.
  Fly    22 PSNEYIKGDFKYVT-----------EYKFNDDGKKVKVVRTFKIEKQI--VPKAVARRRNWVKFG 73

  Fly   250 ADRAIKELNGTTPKNSTEPITVKFANN---PSSNKNSMQPLAAYIAPQNTRGGRAFPANA----- 306
            ..|:.|....:....::|.|.::|..:   ..:::..:.| ...||......|..:..|.     
  Fly    74 DSRSDKPGPNSQTTMASEEIFMQFIGSKDFDQTHETQLDP-GKNIAKCRICNGEHWSVNCPYKGT 137

  Fly   307 --------AAGAAAAAAAAAIHPN-AGRYSSVISRYSPLTSDLITNGMIQGNTIASSGW------ 356
                    ...|.||||||...|: .|:|      ..|...|   .|.|.|    |..|      
  Fly   138 SMDSKTVMETKANAAAAAAISDPSKTGKY------VPPFMKD---GGGISG----SKNWGRGRDR 189

  Fly   357 ----CIFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQSL 417
                .:.:.||:....|..|.:|....|....:.:.|:..|..||||.:|.....::|..||:.|
  Fly   190 DDSSAVRISNLSESMTETDLEELVKKIGPHTKMYLAREKNSGLCKGFAYVHFKFRQDAAAAIEVL 254

  Fly   418 NGYTLGNRVLQVSF 431
            ||:...:.:|.|.:
  Fly   255 NGHGYDHLILCVEW 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp9NP_001259974.1 ELAV_HUD_SF 107..438 CDD:273741 65/274 (24%)
RRM1_Hu 109..186 CDD:241094
RRM2_Hu 196..274 CDD:241096 15/80 (19%)
RRM3_Hu 355..432 CDD:240823 22/87 (25%)
eIF3g2NP_650887.1 eIF3g 28..137 CDD:289149 23/122 (19%)
RRM <171..>256 CDD:223796 23/91 (25%)
RRM_eIF3G_like 194..270 CDD:240854 21/75 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.