DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp9 and CG5213

DIOPT Version :9

Sequence 1:NP_001259974.1 Gene:Rbp9 / 33498 FlyBaseID:FBgn0010263 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster


Alignment Length:193 Identity:68/193 - (35%)
Similarity:105/193 - (54%) Gaps:7/193 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 EPDP-------KTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQE 162
            :|.|       |||||:|||||.|::.|:..||..|||:...|:||.:.||.|..||||:||.:.
  Fly    29 DPPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSER 93

  Fly   163 DAEKAINALNGLRLQNKTIKVSIARPSSESIKGANLYVSGLPKNMTQSDLESLFSPYGKIITSRI 227
            .|..|:|.::|...:.|.:||:.||||......::|||..||..|.:..:..||:.||.|:...:
  Fly    94 QAAAAVNGMDGYETRGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNL 158

  Fly   228 LCDNITGLSKGVGFIRFDQRFEADRAIKELNGTTPKNSTEPITVKFANNPSSNKNSMQPLAAY 290
            |.......|:||.|::|:...:|:.|...::....:.::.|:||||........:|....:.|
  Fly   159 LRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGSSSTSSGSQY 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp9NP_001259974.1 ELAV_HUD_SF 107..438 CDD:273741 67/191 (35%)
RRM1_Hu 109..186 CDD:241094 36/76 (47%)
RRM2_Hu 196..274 CDD:241096 23/77 (30%)
RRM3_Hu 355..432 CDD:240823
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 35/75 (47%)
RRM 128..202 CDD:214636 20/73 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - mtm1072
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.