DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp9 and Spx

DIOPT Version :9

Sequence 1:NP_001259974.1 Gene:Rbp9 / 33498 FlyBaseID:FBgn0010263 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_511058.1 Gene:Spx / 31558 FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster


Alignment Length:203 Identity:64/203 - (31%)
Similarity:99/203 - (48%) Gaps:27/203 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 LPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAINALNGLRLQNKTI 181
            |...:|:..:..|||..|.|.:..:.:|:||....|||||.::.:|||:..|..:|.::|..|.|
  Fly    20 LDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGIKIMNMIKLYGKPI 84

  Fly   182 KVSIARPSSESIK-GANLYVSGLPKNMTQSDLESLFSPYGKII-TSRILCDNITGLSKGVGFIRF 244
            :|:.|....:::. |||:::..|...:.:..|...||.:|.|: |.:|:.|..||.||...||.|
  Fly    85 RVNKASAHQKNLDVGANIFIGNLDVEVDEKLLYDTFSAFGVILQTPKIMRDPETGKSKSFAFINF 149

  Fly   245 DQRFEA-DRAIKELNGTTPKNSTEPITVKF--------------------ANNPSSNKNSMQPLA 288
             ..||| |.|:..:||....|  .||:|.:                    |.|||::.:....|.
  Fly   150 -ASFEASDAAMDAMNGQYLCN--RPISVSYAFKKDHKGERHGSAAERLLAAQNPSTHADRPHQLF 211

  Fly   289 AYIAPQNT 296
            | .||..|
  Fly   212 A-DAPVQT 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp9NP_001259974.1 ELAV_HUD_SF 107..438 CDD:273741 64/203 (32%)
RRM1_Hu 109..186 CDD:241094 24/68 (35%)
RRM2_Hu 196..274 CDD:241096 29/99 (29%)
RRM3_Hu 355..432 CDD:240823
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780 24/67 (36%)
RRM2_SF3B4 99..181 CDD:240781 30/84 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439635
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.