DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp9 and Elavl4

DIOPT Version :9

Sequence 1:NP_001259974.1 Gene:Rbp9 / 33498 FlyBaseID:FBgn0010263 Length:684 Species:Drosophila melanogaster
Sequence 2:XP_006502856.1 Gene:Elavl4 / 15572 MGIID:107427 Length:397 Species:Mus musculus


Alignment Length:384 Identity:223/384 - (58%)
Similarity:265/384 - (69%) Gaps:53/384 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NNNTNNNNNNNATANNNNNNEP--------DPKTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKL 141
            :|...:|.:|..::||.|...|        |.|||||||||||.|:|:|.||||.|.||:|||||
Mouse    30 SNGPTSNTSNGPSSNNRNCPSPMQTGAATDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKL 94

  Fly   142 IRDKVTGQSLGYGFVNYVKQEDAEKAINALNGLRLQNKTIKVSIARPSSESIKGANLYVSGLPKN 206
            :|||:||||||||||||:..:|||||||.|||||||.||||||.|||||.||:.||||||||||.
Mouse    95 VRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKT 159

  Fly   207 MTQSDLESLFSPYGKIITSRILCDNITGLSKGVGFIRFDQRFEADRAIKELNGTTPKNSTEPITV 271
            |||.:||.|||.||:|||||||.|.:||:|:||||||||:|.||:.|||.|||..|..:||||||
Mouse   160 MTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITV 224

  Fly   272 KFANNPSSNKNSMQPLAAYIAPQNTRGGRAFPANAAAGAAAAAAAAAIHPNAGRY---------- 326
            |||||||...:.......|.:|     .|.:|             ..:|..|.|:          
Mouse   225 KFANNPSQKSSQALLSQLYQSP-----NRRYP-------------GPLHHQAQRFRLDNLLNMAY 271

  Fly   327 ------------SSVISRYSPLTSDLITN--GM-IQGNTIASSGWCIFVYNLAPDTEENVLWQLF 376
                        |:...|:||:|.|.:|:  || |.|:|  .:|||||||||:||::|:||||||
Mouse   272 GVKRLMSGPVPPSACPPRFSPITIDGMTSLVGMNIPGHT--GTGWCIFVYNLSPDSDESVLWQLF 334

  Fly   377 GPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQSLNGYTLGNRVLQVSFKTNK 435
            ||||||.:||||||..:||||||||||||||:||.:||.|||||.||:|||||||||||
Mouse   335 GPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp9NP_001259974.1 ELAV_HUD_SF 107..438 CDD:273741 216/354 (61%)
RRM1_Hu 109..186 CDD:241094 61/76 (80%)
RRM2_Hu 196..274 CDD:241096 56/77 (73%)
RRM3_Hu 355..432 CDD:240823 61/76 (80%)
Elavl4XP_006502856.1 ELAV_HUD_SF 60..396 CDD:273741 216/354 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5668
eggNOG 1 0.900 - - E1_KOG0145
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40729
Inparanoid 1 1.050 420 1.000 Inparanoid score I1774
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - mtm8744
orthoMCL 1 0.900 - - OOG6_103306
Panther 1 1.100 - - O PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X326
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.820

Return to query results.
Submit another query.