DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp9 and Elavl1

DIOPT Version :9

Sequence 1:NP_001259974.1 Gene:Rbp9 / 33498 FlyBaseID:FBgn0010263 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_034615.2 Gene:Elavl1 / 15568 MGIID:1100851 Length:326 Species:Mus musculus


Alignment Length:331 Identity:200/331 - (60%)
Similarity:241/331 - (72%) Gaps:28/331 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 KTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAINALNG 173
            :||||||||||.|:|:|:||||.|.|||||.|||||||.|.||||||||||..:|||:||:.|||
Mouse    19 RTNLIVNYLPQNMTQEELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAISTLNG 83

  Fly   174 LRLQNKTIKVSIARPSSESIKGANLYVSGLPKNMTQSDLESLFSPYGKIITSRILCDNITGLSKG 238
            ||||:||||||.||||||.||.||||:||||:.|||.|:|.:||.:|:||.||:|.|..||||:|
Mouse    84 LRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRG 148

  Fly   239 VGFIRFDQRFEADRAIKELNGTTPKNSTEPITVKFANNPSSNKNSMQPLAAYIAPQNTRGGRAFP 303
            |.|||||:|.||:.||...||..|..|:||||||||.||:.|||.......|.:|....||    
Mouse   149 VAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNMALLSQLYHSPARRFGG---- 209

  Fly   304 ANAAAGAAAAAAAAAIHPNAGRYSSVISRYSPLTSDLIT--NGM-IQGNTIASSGWCIFVYNLAP 365
                          .:|..|.|:     |:||:..|.::  :|: :.||  ||||||||:|||..
Mouse   210 --------------PVHHQAQRF-----RFSPMGVDHMSGISGVNVPGN--ASSGWCIFIYNLGQ 253

  Fly   366 DTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQSLNGYTLGNRVLQVS 430
            |.:|.:|||:|||||||.:||||||..:|||||||||||||||||.:||.|||||.||:::||||
Mouse   254 DADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVS 318

  Fly   431 FKTNKN 436
            |||||:
Mouse   319 FKTNKS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp9NP_001259974.1 ELAV_HUD_SF 107..438 CDD:273741 200/331 (60%)
RRM1_Hu 109..186 CDD:241094 59/76 (78%)
RRM2_Hu 196..274 CDD:241096 48/77 (62%)
RRM3_Hu 355..432 CDD:240823 56/76 (74%)
Elavl1NP_034615.2 ELAV_HUD_SF 19..326 CDD:273741 200/331 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5668
eggNOG 1 0.900 - - E1_KOG0145
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 420 1.000 Inparanoid score I1774
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D425303at33208
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - mtm8744
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X326
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.930

Return to query results.
Submit another query.