DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NTPase and AT2G02970

DIOPT Version :10

Sequence 1:NP_001259972.1 Gene:NTPase / 33495 FlyBaseID:FBgn0024947 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_565293.1 Gene:AT2G02970 / 814826 AraportID:AT2G02970 Length:555 Species:Arabidopsis thaliana


Alignment Length:104 Identity:18/104 - (17%)
Similarity:32/104 - (30%) Gaps:32/104 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 RKFSTAP------EAEEPLFMPVDVIHPEAIEEESLKETAFNGAAEKPIIEECLLEMIEQNDDDM 139
            |.:..||      .|:.....|:|..|....:.|::                 .:.|.|.|.|.:
plant     4 RFYPPAPTSVGTLSADPTCISPLDFYHCNKFDGENM-----------------YMSMNENNQDFL 51

  Fly   140 EGEEVQEEEEEETDGYK---------PSEAALSKLDSSS 169
            ...:....:.|..:.|:         |..:.|..:|..|
plant    52 STNQTYNGQSESNEDYEIPPITPPNMPDPSLLHLVDHES 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NTPaseNP_001259972.1 ASKHA_NBD_NTPDase5-like 142..515 CDD:466896 6/37 (16%)
AT2G02970NP_565293.1 ASKHA_NBD_AtAPY3-like 87..483 CDD:466892 2/4 (50%)

Return to query results.
Submit another query.