DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx6005 and PRDX6

DIOPT Version :9

Sequence 1:NP_523463.2 Gene:Prx6005 / 33493 FlyBaseID:FBgn0031479 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_004896.1 Gene:PRDX6 / 9588 HGNCID:16753 Length:224 Species:Homo sapiens


Alignment Length:220 Identity:133/220 - (60%)
Similarity:153/220 - (69%) Gaps:3/220 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LNIGDQFPNFTAETSEGRIDFYDWMQDSWAILFSHPADFTPVCTTELSRVAALIPEFQKRGVKPI 70
            |.:||..|||.|.|:.|||.|:|::.|||.||||||.||||||||||.|.|.|.|||.||.||.|
Human     5 LLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLI 69

  Fly    71 ALSCDTVESHKGWIEDIKSFG---KLSSFDYPIIADDKRELALKFNMLDKDEINAEGIPLTCRAV 132
            |||.|:||.|..|.:||.::.   ......:|||.|..||||:...|||..|.:.:|:|:|.|.|
Human    70 ALSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVTARVV 134

  Fly   133 FVVDDKKKLRLSILYPATTGRNFDEILRVIDSLQLTQTKSVATPADWKQGGKCMVLPTVKAEDVP 197
            ||....|||:|||||||||||||||||||:.|||||..|.||||.|||.|...|||||:..|:..
Human   135 FVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAK 199

  Fly   198 KLFPDGIETIELPSGKSYLRITPQP 222
            ||||.|:.|.||||||.|||.||||
Human   200 KLFPKGVFTKELPSGKKYLRYTPQP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx6005NP_523463.2 PRX_1cys 8..220 CDD:239314 128/214 (60%)
AhpC 8..198 CDD:223527 113/192 (59%)
PRDX6NP_004896.1 PRX_1cys 7..222 CDD:239314 128/214 (60%)
Required and sufficient for targeting to lysosomes and lamellar bodies. /evidence=ECO:0000250|UniProtKB:O35244 31..40 7/8 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11445
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3606
Inparanoid 1 1.050 260 1.000 Inparanoid score I3123
Isobase 1 0.950 - 0 Normalized mean entropy S632
OMA 1 1.010 - - QHG60653
OrthoDB 1 1.010 - - D1129256at2759
OrthoFinder 1 1.000 - - FOG0002615
OrthoInspector 1 1.000 - - oto90009
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - LDO PTHR43503
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2241
SonicParanoid 1 1.000 - - X1721
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.820

Return to query results.
Submit another query.