DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx6005 and Prdx6

DIOPT Version :9

Sequence 1:NP_523463.2 Gene:Prx6005 / 33493 FlyBaseID:FBgn0031479 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_446028.1 Gene:Prdx6 / 94167 RGDID:71005 Length:224 Species:Rattus norvegicus


Alignment Length:220 Identity:129/220 - (58%)
Similarity:155/220 - (70%) Gaps:3/220 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LNIGDQFPNFTAETSEGRIDFYDWMQDSWAILFSHPADFTPVCTTELSRVAALIPEFQKRGVKPI 70
            |.:||:.|||.|.|:.|.|.|:|::.|||.||||||.||||||||||.|.|.|.|||.||.||.|
  Rat     5 LLLGDEAPNFEANTTIGHIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLI 69

  Fly    71 ALSCDTVESHKGWIEDIKSF---GKLSSFDYPIIADDKRELALKFNMLDKDEINAEGIPLTCRAV 132
            |||.|:||.|..|.:||.::   .......:|||.|..|:||:...|||..|.:.:|:|:|.|.|
  Rat    70 ALSIDSVEDHFAWSKDINAYNGAAPTEKLPFPIIDDKDRDLAILLGMLDPAEKDEKGMPVTARVV 134

  Fly   133 FVVDDKKKLRLSILYPATTGRNFDEILRVIDSLQLTQTKSVATPADWKQGGKCMVLPTVKAEDVP 197
            |:....|||:|||||||||||||||||||:||||||.:..||||.|||:|...|||||:..|:..
  Rat   135 FIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTASNPVATPVDWKKGESVMVLPTLPEEEAK 199

  Fly   198 KLFPDGIETIELPSGKSYLRITPQP 222
            :|||.|:.|.||||||.|||.||||
  Rat   200 QLFPKGVFTKELPSGKKYLRYTPQP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx6005NP_523463.2 PRX_1cys 8..220 CDD:239314 124/214 (58%)
AhpC 8..198 CDD:223527 110/192 (57%)
Prdx6NP_446028.1 AhpC 5..200 CDD:223527 111/194 (57%)
PRX_1cys 7..222 CDD:239314 124/214 (58%)
Required and sufficient for targeting to lysosomes and lamellar bodies. /evidence=ECO:0000269|PubMed:19700648 31..40 7/8 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11571
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3606
Inparanoid 1 1.050 256 1.000 Inparanoid score I3079
OMA 1 1.010 - - QHG60653
OrthoDB 1 1.010 - - D1129256at2759
OrthoFinder 1 1.000 - - FOG0002615
OrthoInspector 1 1.000 - - oto97123
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - LDO PTHR43503
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1721
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.