DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx6005 and TSA1

DIOPT Version :9

Sequence 1:NP_523463.2 Gene:Prx6005 / 33493 FlyBaseID:FBgn0031479 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_013684.1 Gene:TSA1 / 854980 SGDID:S000004490 Length:196 Species:Saccharomyces cerevisiae


Alignment Length:196 Identity:56/196 - (28%)
Similarity:89/196 - (45%) Gaps:18/196 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QFPNF--TAET----SEGRIDFYDWMQDSWAILFSHPADFTPVCTTELSRVAALIPEFQKRGVKP 69
            |.|.|  ||..    .|..:|.|   :..:.:|...|..||.||.||:...:....:|:::|.:.
Yeast     8 QAPTFKKTAVVDGVFDEVSLDKY---KGKYVVLAFIPLAFTFVCPTEIIAFSEAAKKFEEQGAQV 69

  Fly    70 IALSCDTVESHKGWIEDIKSFGKLSSFDYPIIADDKRELALKFNMLDKDEINAEGIPLTCRAVFV 134
            :..|.|:..|...|....:..|.|...:.|::||....|:..:.:|    |..||:.|  |.:|:
Yeast    70 LFASTDSEYSLLAWTNIPRKEGGLGPINIPLLADTNHSLSRDYGVL----IEEEGVAL--RGLFI 128

  Fly   135 VDDKKKLRLSILYPATTGRNFDEILRVIDSLQLTQTKSVATPADWKQGGKCMVLPTVKAEDVPKL 199
            :|.|..:|...:.....|||.||.||::::.|.|.......|.:|..|. ..:.|||  ||..:.
Yeast   129 IDPKGVIRHITINDLPVGRNVDEALRLVEAFQWTDKNGTVLPCNWTPGA-ATIKPTV--EDSKEY 190

  Fly   200 F 200
            |
Yeast   191 F 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx6005NP_523463.2 PRX_1cys 8..220 CDD:239314 56/196 (29%)
AhpC 8..198 CDD:223527 55/192 (29%)
TSA1NP_013684.1 PRX_Typ2cys 5..176 CDD:239313 49/176 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.