DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx6005 and PRDX2

DIOPT Version :9

Sequence 1:NP_523463.2 Gene:Prx6005 / 33493 FlyBaseID:FBgn0031479 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_005800.3 Gene:PRDX2 / 7001 HGNCID:9353 Length:198 Species:Homo sapiens


Alignment Length:207 Identity:63/207 - (30%)
Similarity:97/207 - (46%) Gaps:23/207 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGKALNIGDQFPNFTAET------SEGRIDFYDWMQDSWAILFSHPADFTPVCTTELSRVAALIP 60
            ||.| .||...|:|.|..      .|.::..|   :..:.:||.:|.|||.||.||:...:....
Human     3 SGNA-RIGKPAPDFKATAVVDGAFKEVKLSDY---KGKYVVLFFYPLDFTFVCPTEIIAFSNRAE 63

  Fly    61 EFQKRGVKPIALSCDTVESHKGWIEDIKSFGKLSSFDYPIIADDKRELALKFNMLDKDEINAEGI 125
            :|:|.|.:.:.:|.|:..:|..||...:..|.|...:.|::||..|.|:..:.:|..|    |||
Human    64 DFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTD----EGI 124

  Fly   126 PLTCRAVFVVDDKKKLRLSILYPATTGRNFDEILRVIDSLQLTQTKSVATPADWKQGGKCMVLPT 190
              ..|.:|::|.|..||...:.....||:.||.||::.:.|.|.......||.||.|.     .|
Human   125 --AYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGS-----DT 182

  Fly   191 VK--AEDVPKLF 200
            :|  .:|..:.|
Human   183 IKPNVDDSKEYF 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx6005NP_523463.2 PRX_1cys 8..220 CDD:239314 60/201 (30%)
AhpC 8..198 CDD:223527 59/197 (30%)
PRDX2NP_005800.3 PRX_Typ2cys 8..179 CDD:239313 55/179 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.