DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx6005 and prdx4

DIOPT Version :9

Sequence 1:NP_523463.2 Gene:Prx6005 / 33493 FlyBaseID:FBgn0031479 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001082894.1 Gene:prdx4 / 570477 ZFINID:ZDB-GENE-030131-1096 Length:260 Species:Danio rerio


Alignment Length:196 Identity:51/196 - (26%)
Similarity:87/196 - (44%) Gaps:29/196 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ETSEGRIDFYDWMQDSWAILFSHPADFTPVCTTELSRVAALIPEFQKRGVKPIALSCDTVESHKG 82
            |..|.::..|   :..:.:.|.:|.|||.||.||:...:..:.|||....:.:|.|.|:..:|..
Zfish    86 EFKELKLSDY---KGKYLVFFFYPLDFTFVCPTEIIAFSDRVHEFQAINAEVVACSVDSQFTHLA 147

  Fly    83 WIEDIKSFGKLSSFDYPIIADDKRELALKFNMLDKDEINAEGIPLTCRAVFVVDDKKKLRLSILY 147
            ||...:..|.|.....|:::|...:::..:.:..:|:.:      |.|.:|::|.|..||...:.
Zfish   148 WINTPRKQGGLGPMKIPLLSDLTHQISKDYGVFLEDQGH------TLRGLFIIDGKGVLRQITMN 206

  Fly   148 PATTGRNFDEILRVIDSLQLTQTKSVATPADWKQGGKCMVLPTVKAEDVPKLFPDGIETIELPSG 212
            ....||:.||.||::.:.|.|.......||.||.|...::             ||       |:|
Zfish   207 DLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSDTII-------------PD-------PAG 251

  Fly   213 K 213
            |
Zfish   252 K 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx6005NP_523463.2 PRX_1cys 8..220 CDD:239314 51/196 (26%)
AhpC 8..198 CDD:223527 46/179 (26%)
prdx4NP_001082894.1 PTZ00253 68..256 CDD:140280 51/196 (26%)
PRX_Typ2cys 70..241 CDD:239313 45/163 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.