Sequence 1: | NP_523463.2 | Gene: | Prx6005 / 33493 | FlyBaseID: | FBgn0031479 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001189360.1 | Gene: | PRDX1 / 5052 | HGNCID: | 9352 | Length: | 199 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 67/203 - (33%) |
---|---|---|---|
Similarity: | 97/203 - (47%) | Gaps: | 18/203 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSGKALNIGDQFPNF--TAETSEGR---IDFYDWMQDSWAILFSHPADFTPVCTTELSRVAALIP 60
Fly 61 EFQKRGVKPIALSCDTVESHKGWIEDIKSFGKLSSFDYPIIADDKRELALKFNMLDKDEINAEGI 125
Fly 126 PLTCRAVFVVDDKKKLRLSILYPATTGRNFDEILRVIDSLQLTQTKSVATPADWKQGGKCMVLPT 190
Fly 191 VKAEDVPK 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prx6005 | NP_523463.2 | PRX_1cys | 8..220 | CDD:239314 | 65/196 (33%) |
AhpC | 8..198 | CDD:223527 | 64/194 (33%) | ||
PRDX1 | NP_001189360.1 | PRX_Typ2cys | 8..180 | CDD:239313 | 59/178 (33%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 176..199 | 8/21 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0450 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100111 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.710 |