DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx6005 and Prx3

DIOPT Version :9

Sequence 1:NP_523463.2 Gene:Prx6005 / 33493 FlyBaseID:FBgn0031479 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster


Alignment Length:201 Identity:53/201 - (26%)
Similarity:94/201 - (46%) Gaps:14/201 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ALNIGDQFPNF----TAETSEGRIDFYDWMQDSWAILFSHPADFTPVCTTELSRVAALIPEFQKR 65
            |:.:....|:|    ..:.|...:...|: :..:.:||.:|.|||.||.||:...:..|.||...
  Fly    39 AVRVQQPAPDFKGLAVVDNSFQEVKLEDY-RGKYLVLFFYPLDFTFVCPTEIVAFSERIKEFHDI 102

  Fly    66 GVKPIALSCDTVESHKGWIEDIKSFGKLSSFDYPIIADDKRELALKFNMLDKDEINAEGIPLTCR 130
            ..:.:.:|.|:..||..|....:..|.:....||:::|..::::..:::|    ::.|||.|  |
  Fly   103 NTEVLGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVL----LDKEGISL--R 161

  Fly   131 AVFVVDDKKKLRLSILYPATTGRNFDEILRVIDSLQLTQTKSVATPADWK-QGGKCMVLPTVKAE 194
            ..|::|....||...:.....||:.||:||:|.:.|..:......||:|. ......:.|.|  |
  Fly   162 GTFIIDPNGILRQYSINDLPVGRSVDEVLRLIKAFQFVEQHGEVCPANWNPNSNPATIKPDV--E 224

  Fly   195 DVPKLF 200
            :..|.|
  Fly   225 ESKKYF 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx6005NP_523463.2 PRX_1cys 8..220 CDD:239314 52/198 (26%)
AhpC 8..198 CDD:223527 50/194 (26%)
Prx3NP_524387.1 AhpC 40..233 CDD:223527 52/200 (26%)
PRX_Typ2cys 42..212 CDD:239313 47/176 (27%)
1-cysPrx_C 195..232 CDD:287400 9/38 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446104
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.