DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx6005 and prdx6

DIOPT Version :9

Sequence 1:NP_523463.2 Gene:Prx6005 / 33493 FlyBaseID:FBgn0031479 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_989102.1 Gene:prdx6 / 394706 XenbaseID:XB-GENE-951731 Length:224 Species:Xenopus tropicalis


Alignment Length:220 Identity:122/220 - (55%)
Similarity:157/220 - (71%) Gaps:3/220 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LNIGDQFPNFTAETSEGRIDFYDWMQDSWAILFSHPADFTPVCTTELSRVAALIPEFQKRGVKPI 70
            |.:|:.||:|.|:|:.|||.|::::..||.:|||||.|:||||||||.|...|.|||:||.|:.|
 Frog     4 LLLGEIFPDFEADTTIGRIKFHEFLGGSWGVLFSHPRDYTPVCTTELGRCVKLAPEFKKRNVRMI 68

  Fly    71 ALSCDTVESHKGWIEDIKSFG---KLSSFDYPIIADDKRELALKFNMLDKDEINAEGIPLTCRAV 132
            |||.|:||.|.||.:||.|:.   ...:..:|||||.||:||:|..|||.||.:.:|:|:|.|.|
 Frog    69 ALSIDSVEDHLGWSKDINSYNCDEPTETLPFPIIADPKRDLAVKLGMLDPDEKDMQGMPVTARCV 133

  Fly   133 FVVDDKKKLRLSILYPATTGRNFDEILRVIDSLQLTQTKSVATPADWKQGGKCMVLPTVKAEDVP 197
            |::...||::|||||||||||||||||||:||||||...:||||.|||.|.:.||.|.|..|:..
 Frog   134 FIIGPDKKMKLSILYPATTGRNFDEILRVVDSLQLTAVHNVATPVDWKPGDRVMVPPNVPEEEAS 198

  Fly   198 KLFPDGIETIELPSGKSYLRITPQP 222
            ||:|.|:....|||.|:|||.|..|
 Frog   199 KLYPSGVFNKALPSRKNYLRYTAHP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx6005NP_523463.2 PRX_1cys 8..220 CDD:239314 119/214 (56%)
AhpC 8..198 CDD:223527 108/192 (56%)
prdx6NP_989102.1 PRX_1cys 6..220 CDD:239314 119/213 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3606
Inparanoid 1 1.050 250 1.000 Inparanoid score I3149
OMA 1 1.010 - - QHG60653
OrthoDB 1 1.010 - - D1129256at2759
OrthoFinder 1 1.000 - - FOG0002615
OrthoInspector 1 1.000 - - oto103819
Panther 1 1.100 - - LDO PTHR43503
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2241
SonicParanoid 1 1.000 - - X1721
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.