DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx6005 and prdx2

DIOPT Version :9

Sequence 1:NP_523463.2 Gene:Prx6005 / 33493 FlyBaseID:FBgn0031479 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_989001.1 Gene:prdx2 / 394597 XenbaseID:XB-GENE-945852 Length:206 Species:Xenopus tropicalis


Alignment Length:190 Identity:57/190 - (30%)
Similarity:92/190 - (48%) Gaps:12/190 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NIGDQFPNFTAETSEGRIDFYD-WMQD---SWAILFSHPADFTPVCTTELSRVAALIPEFQKRGV 67
            :||...|.|.| |:....:|.| .:.|   .:.:||.:|.|||.||.||:...:....:|.|...
 Frog    15 HIGQPAPAFKA-TAVVNGEFKDIQLSDYLGKYVVLFFYPLDFTFVCPTEIIAFSDHAGDFSKINC 78

  Fly    68 KPIALSCDTVESHKGWIEDIKSFGKLSSFDYPIIADDKRELALKFNMLDKDEINAEGIPLTCRAV 132
            :.||:|.|:..:|..|....:..|.|...:.|:::|....:|..:.:| |:|   :|:  ..|.:
 Frog    79 QLIAVSVDSQFTHLAWTNVPRKEGGLGPINIPLVSDLTHSIAKDYGVL-KEE---DGV--AYRGL 137

  Fly   133 FVVDDKKKLRLSILYPATTGRNFDEILRVIDSLQLTQTKSVATPADWKQGGKCMVLPTVK 192
            |::|.|..||...:.....||:.:|.||::.:.|.|.......||.||.|.. .:.|.||
 Frog   138 FIIDGKGNLRQITINDLPVGRSVEETLRLVQAFQYTDQHGEVCPAGWKPGSS-TIKPNVK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx6005NP_523463.2 PRX_1cys 8..220 CDD:239314 57/189 (30%)
AhpC 8..198 CDD:223527 57/189 (30%)
prdx2NP_989001.1 PRX_Typ2cys 16..187 CDD:239313 53/177 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.