DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx6005 and prdx3

DIOPT Version :9

Sequence 1:NP_523463.2 Gene:Prx6005 / 33493 FlyBaseID:FBgn0031479 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001013478.3 Gene:prdx3 / 373079 ZFINID:ZDB-GENE-030826-18 Length:250 Species:Danio rerio


Alignment Length:200 Identity:47/200 - (23%)
Similarity:82/200 - (41%) Gaps:36/200 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KALNIGDQFPNFTAETSEGRIDFYDWMQDSWAILFSHPADFTPVCTTELSRVAALIPEFQKRGVK 68
            |.:::||                   .:..:.:||.:|.|||.||.||:...:....||......
Zfish    78 KEISLGD-------------------FKGKYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCA 123

  Fly    69 PIALSCDTVESHKGWIEDIKSFGKLSSFDYPIIADDKRELALKFNMLDKDEINAEGIPLTCRAVF 133
            .:.:|.|:..:|..|....:..|.|.....|::||..::::..:.:|      .||..:..|.:|
Zfish   124 VVGVSVDSHFTHLAWTNTPRKSGGLGKIQIPLLADLTKQVSRDYGVL------LEGPGIALRGLF 182

  Fly   134 VVDDKKKLRLSILYPATTGRNFDEILRVIDSLQLTQTKSVATPADWKQGGKCMVLPTVKAEDVPK 198
            ::|....:|...:.....||:.:|.||::.:.|..:|.....||.|....     ||:|..    
Zfish   183 IIDPNGIVRHMSVNDLPVGRSVEETLRLVKAFQFVETHGEVCPASWTPKS-----PTIKPT---- 238

  Fly   199 LFPDG 203
              |||
Zfish   239 --PDG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx6005NP_523463.2 PRX_1cys 8..220 CDD:239314 45/195 (23%)
AhpC 8..198 CDD:223527 43/189 (23%)
prdx3NP_001013478.3 PRX_Typ2cys 60..230 CDD:239313 41/176 (23%)
PTZ00253 64..250 CDD:140280 46/199 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.